SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011885 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011885
Domain Number 1 Region: 11-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-59
Family Allantoicase repeat 0.0000918
Further Details:      
 
Domain Number 2 Region: 208-388
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-49
Family Allantoicase repeat 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011885   Gene: ENSECAG00000014068   Transcript: ENSECAT00000014848
Sequence length 412
Comment pep:known chromosome:EquCab2:15:88505767:88529774:-1 gene:ENSECAG00000014068 transcript:ENSECAT00000014848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSPKEGKWARAPDFTQLTDMASESVGGQILFATDDFFAPAENLIKSDSPSFKEHEYTE
FGKWMDGWETRRKRIPGHDWCIIRLGVQGIIRGFDVDISYFTGDYAPQMSIQAACFEEDK
QPEIPARGIRMGAAASPEEFEAIAELKSDDWDYLVPMTELKPGRPASSHNYFPVNSQQRW
THIRLNIFPDGGIARFRVYGTGQKDWTASDSKEPSDLVTIAYGGVCVGFSNTHFGHPNNM
IGVGPAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITQIEIDTKY
FKGNYPDSCKLDGCILTTLEEEDMIRQKWDLPGHKWKPLLPVTKLSPNKSHLFDSLTLEL
QDVITHVRFTISPDGGVSRLRLKGFPSSICLLRPREKPMMRFSVKAGFRANL
Download sequence
Identical sequences F7AJG7
9796.ENSECAP00000011885 XP_001502911.2.31192 XP_005600290.1.31192 ENSECAP00000011885 ENSECAP00000011885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]