SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011895 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011895
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-75
Family Ephrin receptor ligand binding domain 0.000000842
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 5.32e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-981
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.35e-20
Family SAM (sterile alpha motif) domain 0.0000452
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011895
Domain Number - Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000141
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011895   Gene: ENSECAG00000012752   Transcript: ENSECAT00000014859
Sequence length 986
Comment pep:known chromosome:EquCab2:6:10664633:10795122:-1 gene:ENSECAG00000012752 transcript:ENSECAT00000014859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYFLLFSFLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDSSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQDDLARIGITAVT
HQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences F7AJ26
ENSECAP00000011895 XP_003365173.1.31192 XP_014698741.1.49734 ENSECAP00000011895 9796.ENSECAP00000011895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]