SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011924 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011924
Domain Number 1 Region: 224-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-64
Family Eukaryotic proteases 0.000000106
Further Details:      
 
Domain Number 2 Region: 51-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-20
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 185-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000029
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011924   Gene: ENSECAG00000014251   Transcript: ENSECAT00000014889
Sequence length 483
Comment pep:known chromosome:EquCab2:6:34552952:34567899:-1 gene:ENSECAG00000014251 transcript:ENSECAT00000014889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSRCLFSEWGNHLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQKLTSPR
YPEPYLKGQESSIDIKAPEGFAVRLVFQDFDLEPSQDCERDSVTITASGMDPSRFCGQQG
SPLGSPPGQKEFVSSSSLRLTFRAPASSEDRTTHLHKGFLALYQAVGNQANGGSEATHTP
GDNPSKIQNHCQEPYYQAVPAGTLGCTSQGPWKETQDSKEAPHCVPVCGRPVTPITHNQD
VLGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSIFPGKNRSVNVFLG
HTNIDEMLKLGNHPVRRVVVHPDYRQNESHNFNGDIALLELQHSVPLGPSLLPICLPDSE
TLYVSGLWGYVSGFGVEMGWLTTELKYSRLPVAPREACKAWLQEKQRTEVFSDNMFCVGD
KMRPQSVCQGDSGGVYVVWDDRTHHWVATGIVSWGIGCGKGYGFYTKVLNYMDWIKGVMD
GKD
Download sequence
Identical sequences F7A1L2
ENSECAP00000011924 9796.ENSECAP00000011924 ENSECAP00000011924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]