SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011951 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011951
Domain Number 1 Region: 705-937
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.59e-31
Family beta 1,4 galactosyltransferase (b4GalT1) 0.09
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011951
Domain Number - Region: 107-146,175-210
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0222
Family Anthrax protective antigen 0.026
Further Details:      
 
Domain Number - Region: 613-665
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.034
Family Cystatins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011951   Gene: ENSECAG00000014031   Transcript: ENSECAT00000014921
Sequence length 943
Comment pep:known chromosome:EquCab2:6:30100068:30125269:-1 gene:ENSECAG00000014031 transcript:ENSECAT00000014921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGSWRELAKALASRNIPAVDPNLQFYHPQRLGLKDQDLERGGSRNSSYLKWNKPVPWLSE
FRGRVNLHVFEDWCGSSIQQLRRNLHFPLYPHIRTTLRKLAVAPKWTNYGLRIFGYLHPF
TDGKIQFAIAADDNAEFWLSRDDQVSGLRLLASVGKTGKEWTAPGEFGKFWSQISKPVSL
SASQRYYFEVLHKQNDEGTDHVEVAWRRNDPGAKFTLIDSPSLSLFTNETLLRMDEVGHI
PQTAASHVGSPDALPREEQPPADMLRPDPRDTLYRVPLIPKSHLRHVLPDCAYKPSYLVD
GLPLQRYQGLRFVHLSFVYPNDYTRLSHMETHNKCFYQENTYYQDRFSFQEYIKIDQPEK
QGPEQPGFEEALLEESQYGEAAQETPASDEQNARMPEGKPVPTSTPGQEVTDYRLRSLRK
LLAQPQEGLLAPFSKQNSTAPFPLRTSDIPVQLPEKRERKPIPEPSQDPPHSDKWPPGHQ
AGNLPQVKHPRPTDDSPRKTLGQSQWLNQVESYIAEQRRGDRMEPLAPRRGWHGEEEVVA
AADQEGQVEGEEDGEEEEEEEDVNEGFEYVPMFDPVVNWDQTFSARNLDFQALRTDWIDL
NCNTSGNLLLPEQEALEVTRVFLKKLNQRSRGRYQLQRIVNVEKRQDQLRGGRYLLELEL
LDQGQRLVRLSEYVSTRGWQGIDPAGGEEPEARNLQGLVWSPHNHRRQVLNVQTPEPKLC
WPQGFSWNHRAVVHFIVPVKNQARWVQQFIRDMEKLFQVTSDPHFNVIITDYNSEDMDIE
MALKRSKLRSYQYMKLSGNFERSAGLQAGIDLVKDPHSIIFLCDLHIHFPAGVVDTIRKH
CVEGKMAFAPMVMRLHCGATPQWPEGYWEVNGFGLLGIYKSDLDRIGGMNTREFRDRWGG
EDWELLDRILQAGLEVERLSLRNFFHHFHSKRGMWNRRQMKMP
Download sequence
Identical sequences F6ZWW1
ENSECAP00000011951 9796.ENSECAP00000011951 ENSECAP00000011951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]