SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012022 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012022
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 169-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-19
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012022   Gene: ENSECAG00000014149   Transcript: ENSECAT00000015000
Sequence length 533
Comment pep:known chromosome:EquCab2:8:87575100:87678939:-1 gene:ENSECAG00000014149 transcript:ENSECAT00000015000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYGRSLFHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPE
GIVESIQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVGDLKAKFCSTVANDVMLRTGLAVIRLWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKASLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL
RRSSSKCVHDHHCGSQLSSAKGSRSNLSTRDASVLTEMPPQPVKPLIPPMNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences F7D573
9796.ENSECAP00000012022 ENSECAP00000012022 ENSECAP00000012022 XP_001493336.2.31192 XP_014583367.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]