SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012129 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012129
Domain Number 1 Region: 3872-4087
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 5.76e-77
Family Fibrinogen C-terminal domain-like 0.00000268
Further Details:      
 
Domain Number 2 Region: 3607-3695
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-20
Family Fibronectin type III 0.0000876
Further Details:      
 
Domain Number 3 Region: 3695-3865
Classification Level Classification E-value
Superfamily Fibronectin type III 4.66e-19
Family Fibronectin type III 0.00000815
Further Details:      
 
Domain Number 4 Region: 3298-3386
Classification Level Classification E-value
Superfamily Fibronectin type III 2.82e-18
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 1035-1128
Classification Level Classification E-value
Superfamily Fibronectin type III 9.31e-18
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 6 Region: 1240-1330
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 3509-3603
Classification Level Classification E-value
Superfamily Fibronectin type III 7.79e-17
Family Fibronectin type III 0.00000299
Further Details:      
 
Domain Number 8 Region: 1961-2051
Classification Level Classification E-value
Superfamily Fibronectin type III 8.25e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 2278-2368
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 10 Region: 1450-1532
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-16
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 11 Region: 3413-3502
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 12 Region: 2170-2261
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 13 Region: 711-799
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-16
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 14 Region: 2601-2693
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 15 Region: 2494-2585
Classification Level Classification E-value
Superfamily Fibronectin type III 3.24e-16
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 16 Region: 3108-3273
Classification Level Classification E-value
Superfamily Fibronectin type III 5.12e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 17 Region: 2068-2150
Classification Level Classification E-value
Superfamily Fibronectin type III 5.97e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 18 Region: 3011-3101
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000113
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 19 Region: 1351-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000141
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 20 Region: 1862-1944
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000279
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 21 Region: 2911-2994
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000315
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 22 Region: 1131-1219
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000348
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 23 Region: 1542-1628
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000377
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 24 Region: 1649-1731
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000487
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 25 Region: 2708-2791
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000537
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 26 Region: 2389-2479
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000674
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 27 Region: 1754-1836
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000832
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 28 Region: 934-1016
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000876
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 29 Region: 631-711
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000794
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 30 Region: 837-911
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000738
Family Fibronectin type III 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012129
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 284-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 500-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.052
Further Details:      
 
Domain Number - Region: 191-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 315-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 596-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.062
Further Details:      
 
Domain Number - Region: 222-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 529-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Integrin beta EGF-like domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012129   Gene: ENSECAG00000013685   Transcript: ENSECAT00000015121
Sequence length 4096
Comment pep:known chromosome:EquCab2:20:31717209:31765818:-1 gene:ENSECAG00000013685 transcript:ENSECAT00000015121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAQCSLTSNLALLVLLGTVQAGPFSPRSNVTLPAPRPPPQPGGRTEEPRRGSPSSQLY
EHTVQGGEKQVVFTHRINLPPSSGCGCPPGTEPPVPASEVQALRIRLEILEELVKGLKEQ
CTGGCCPAAAQAGTGQTDVRSLCSLHGVFDLSRCSCSCEPGWGGPTCSDPTDNEMPSSSP
PSATGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPEDCHGRGRCVQGVCVCRSGFS
GSDCSLRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGMKSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQKGRCEDGRCVCDPGYAGEDCGSRSCPWDCGEGGRCVDGRCVCW
PGYAGEDCGTRTCPRDCRGRGRCEDGECIDAGYSGDDCGVRSCPGDCHQRGRCEDGRCVC
WPGCRPSKFIPWCILNPLYIYDIGGGCAAGASLGEGLSAGVCARDNCFSTALCDNRGVWF
LWEARAGEDSPLRTFLYKHRRGRCEHGRCVCDSGYTGPSCSTRTCPADCRGRGRCVQGVC
VCHAGYSGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPEDCRGRG
ECREGSCICQDGYAGEDCGEEVPGIESMRMHLLEETTVRTEWTRAPGPVDAYEIQFIPTT
EGVSPPFTARVPSSASVYDQRGLAPGQEYQVTVRALRGTSWGPPASKTITTMIDGPQDLR
VVGVTPTTLELSWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMPGVEYVVT
VTAERGRAVSYPASVRANTGSSPSGLLGATDEPPPSGPSTTQGVRAPVLQQRPQELAELR
VLGKDKTGHLRVAWTAQPDTFAHFQLRLSVPEGPEVHEELLPGNVRQALVPSPPPGAPYE
LSLRGVPPKGEPSAPLIYQGIMDKDGEKPGKPLVPPRLGELTATDATSSSLLLHWTVPEG
EFDSFVIQYKDRDGLQVVPVEGPQRSALITNLDLGRKYKFVLYGLVGKKRHGPLVAEAKI
VPQSDPSPATPPRLGKLWVTDPTPDSLHLSWTVPEGQFDSFVVQYRDRDGRPQVVPVEGP
ERSITVSHLDPDHKYRFSLFGIANKKRHGPLTVDGTTAPEKREEPHHPEAPEQPLLGELT
VTDVTPDSLRLAWTVAQGSFDSFMVQYKDAQGQPQAVPIEGNENEVTIAGLESDRKYKMN
LYGLHGRQRVGPVSVVATTGDPTEVEEAPSSTEPSTEAPEPPEEPLLGELTVTGSSPDSL
SLSWTVPQGHFDFFTVQYKDRDGRPQVVRVGGEENEVTIGGLEPGRKYKMNLYGLYEGQR
VGPVSTVGVTAPQPEETPPATEHPMEPRLGELTVTDVTPNSVGLAWTVPEGQFDSFMIQY
KDRDGQPQVVPVDADQREATVPSLEPAHKYKINFYGLHGGQRMGPLSVIAVTAPLLPAPA
TESLQEPRLGELTVTDVTQDSVGLSWTEPEGEFDSFVVQYKDRDGQPQVVPVAADQREVT
IPGLEPSRKYKFLLFGIQDGKRRSPVSVEAKTAAQGDASPGTPPRLGELWVTDPTPDSLH
LSWTVPEGHFDSFVVQFKDRDGPRVVPVEGHERSVTITPLDTGRKYRFLLYGLLGKRRHG
PLTADGTTETRNTTDNAGTKRPPKPRLGDELQVTSVTPDSVGLSWTVPEGQFDSFVVQYK
DRDGQPQVVPVEGGLREVSISGLDSGRRYKLLLYGLHQGKRMGPISAVAVTAPREEIEAE
TMAPSPPASEPHLGELTLEEATPHTLRLSWTAIQGEFDSFEVQYTDQDGRLQVVNLGGDQ
NDITLSGLESDHRYLVNLYGFHGRQRVGPAQIEALTVPREEEDEPSEPPTMTPEPPFKPH
LGELAVTDATPDSLGLSWTVPEGHFDHFLIQYKNGDGQPKAVRVPGHEDRVTVLGLEPDH
KYKMNLYGFHDGQRVGPISVIGVTEVEETPSLTEPGTEAPEPPEEPLLGELMVTGSSPDS
LSLSWTVPQGHFDFFTVQYKDRDGRPQVVRVRGEEREVTIGGLEPGRKYKMNLYGLYEGH
RVGPVSTVGVTAPKEEPPSSPLWKPHLGELAVTDATSDSLGLSWTVAEGHFDHFLIQYKN
GDGQPKAVRVPGHENRVTVSGLEPDHKYKMNLYGFHGGQRVGPVSTVGLTAPETDQEMSP
APTDLPTTTPEPPFKPRLGELAVTDATPDSLGLSWTVPEGHFDHFLIQYKNGDGQPKAVR
VPGHEDRVTVSGLEPDHKYKMNLYGFHGGQRVGPVSVIGVTEVEESPSPTEPGTEAPEPP
EEPLLGELMVTGSSPDSLSLSWTVPQGHFDFFTVQYKNRDGRPQVVRVRGEENEVTIGGL
EPGRKYKMNLYGLHDGQRMGPVSVVGVTGDPTEVEETPSPIEPSTEAPEPPEEPLLGELM
VTGSSLDSLSLSWTVPQGHFDFFTVQYKDRDGRPQVVRVTGEENEVTIGGLESGRKYKMN
LYGLLEGQRVGPVSTVGITGEKKTSHQTTITDAPEPPEEPLLGELTVTGSSSDSLSLSWT
VPQGHFDFFTMQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMNLYGLYEGQRVGPVS
AVGVTGEWTETPSPTEPSTDAPEPPKEPLLGELMVTGSSPDSLSLSWTVPQGHFDFFTVQ
YKDRDGRPQVLRVRGEENEVTARGLEPGRKYKMNLYGLHEGQRVGPVSTVGTTAPPSEAT
EPPIKPRLGELAVTDATPDSLGLSWTVTEGHFDHFLVQYKNGDGQHKAVRVPGHEDRVTI
SGLEPDHKYKMNLYGFHGGQRIGPVSTVGLTGEAPETGSAGRNNTDSGVPGADPSLSTFE
LVGMSVDTMLSNYRLPLLRKRISTFLHESLHTRAVCGVKGKHTWSRIPKLRPWCVWEKSQ
NPLLEGSPRGMSTPSVYPPTMTPEPPFKPRLGELAVTDATPDSLGLSWTVTEGHFDHFLI
QYKNGDGQPKAVRVPGHEDRVTVSGLEPDHKYKMNLYGFHGGQRVGPVSVIGVTVVEETP
SPTEPSTEAPEPPEEPLLGELMVTGSSPDSLSLSWTVPQGHFDFFTVQYKDRDGRPQVVR
VRGEEREVTIGGLEPRRKYKMHLYGLHEGQRVGPVSTVGMTASLPTEPPVAPRLGELAVA
AVTSNTVRLSWTVAQGPFDSFLVQYRDVQGQPQAVPVGEDLREVTISGLDPARKYRFLLF
GLQDEKRHGPVSAEAKTLPDTKPSPRLGELTVTATTPDSLDLSWTVSEGEFDSFVVQYKD
RDGQPQVVPVAADRHEVTIPGLEPNRKYKFLLYGLAGRKRLGPISADGTTAPLEKEQQPP
PRLGELTVTDETPDSLHLSWTMAQGPFDSFVVQYRDTDGQPRAVPVAADQREVTIEGLEP
GRKYKFLLYGLLGGQRLGPVSVLGVTAPEEDTPAPWHPATEAPEPPKGPHLGTLAVTNGT
PDSLRLSWSVTQGPFDSFVVQYRDTDGQPQALLVGGDQNKVLVSGLEPSTSYKFFLYGLH
EGKRLGPVSAEGTTGSAPPGQTPGEPGPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLR
YGVPSPSTLEPHPRPLLQRELTVPGTRRSAVLRDLRPGILYSLTLYGLRGPHKADSIQGT
ARTLSPVLESPRDLQFSEIGETSAKVSWTPPPSRVDSFKVSYQLADGGEPQSVQVDGRTR
TQRLKGLIPGAQYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTDGSALLHWKPP
QAPVDTYDIRVTAPRAPPLQASAPGSSVDYSLHDLVLHTNYTATVRGLRGPNLTSPASIT
FTTGLEAPRDLEAQEVTPRTAVLTWTEPQVPPTGYLLSFHTPGGQIQEILLPGGITSHQL
RGLFPSTPYSAWLRAMWGESLTPPVSTSFTTGGLRIPFPRDCGEEMQNGPSTSRTTTIFL
NGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISREFWLGNEALH
SLTTAGDYSMRVDLRAGDEAVFAQYDSFRVDSAADYYRLHLEGYHGTAGDSMSYHSGSVF
SARDRDPNNLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYYWKGFDFSVPFT
EMKLRPRSYRPPARGG
Download sequence
Identical sequences F7CCQ6
ENSECAP00000012129 9796.ENSECAP00000012129 ENSECAP00000012129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]