SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012173 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012173
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000895
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 2-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000341
Family EGF-type module 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012173
Domain Number - Region: 43-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012173   Gene: ENSECAG00000014357   Transcript: ENSECAT00000015171
Sequence length 398
Comment pep:known chromosome:EquCab2:31:10071210:10077575:-1 gene:ENSECAG00000014357 transcript:ENSECAT00000015171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIDECGTSPCRNGGSCRDLENSYSCTCPPGFYGRVCELSAMACADGPCFNGGRCSDNPE
GGYTCRCPGGFSGFNCEKKMDACTSSPCANGAQCVDLGDAYLCRCQAGFSGRHCDNNVDD
CASSPCANGGTCRDGVNEYSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHERDRRYLCE
CARGYGGPNCQFLLPEPPPGPVVVDLTEKYVEGQPGPFPWAAVCAGVVLVLMLLLGCAAV
VVCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSVIGATQVKNTNKKADFHRDH
GGAEQDGLKARYPTVDYNLVQDLKGDDTSIRDPHSKRDTKCQPQGSAGEEKGTPTLRGGE
ASERKRPDSVYSTSKDTKYQSVYVISEEKDECVIATEV
Download sequence
Identical sequences F7C2K5
9796.ENSECAP00000012173 ENSECAP00000012173 ENSECAP00000012173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]