SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012260 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012260
Domain Number 1 Region: 944-1155
Classification Level Classification E-value
Superfamily vWA-like 5.15e-34
Family Integrin A (or I) domain 0.0065
Further Details:      
 
Domain Number 2 Region: 716-887
Classification Level Classification E-value
Superfamily vWA-like 5.7e-29
Family Integrin A (or I) domain 0.0083
Further Details:      
 
Domain Number 3 Region: 2-170
Classification Level Classification E-value
Superfamily vWA-like 5.82e-26
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 4 Region: 176-365
Classification Level Classification E-value
Superfamily vWA-like 0.000000000643
Family Integrin A (or I) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012260   Gene: ENSECAG00000014386   Transcript: ENSECAT00000015272
Sequence length 1171
Comment pep:known chromosome:EquCab2:16:66470837:66512051:1 gene:ENSECAG00000014386 transcript:ENSECAT00000015272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSDSEFVTMTTFLSDFIDNFDIQSQRMKIGMAQFGSRYQEIIHLQNSLTKTEWKTQIQTV
TKSHGHPQINLALSKVALMFHPTAGGRGKVGVPQTLVVITSGDPLYDVSDAGRILKDLGI
CVLVLGIGDVHKEQLLPITGNSEKIIAFQDFNKLKDADVKKRMVREICQSCGKINCLVDI
VVGFDISTHLLGQPLFLGHPQLESYLPGILEDITSIRGVSCGRGAEVQVSVAFKVNSNLE
FPVKFQIYQKTVFDSLQQVTVNGPTHLNAEFLQSLWDTFEDKSASRGQVLLIFSDGLGGE
STTMLEQQSDRLREAGLDALLVVSLNTNAHDEFSSFEFGKGFDYRTHLTIGMRELGKMLS
QYLGNIAERACCCTLCRCPGIPGPQGTRGLPASKGSPGLKGSRGHRGESGDPGGRGDIGP
QGDKGTAGCPGEQGQKGARGFPGYKGEYGADGIAGLDGEEGVHGFPGKKGEKGDPGSQGR
PGSRGPPGGYGEKGFPGDPGNPGRNSDIKGQKGSRGEQGRQGRTGQKGTQGSPNSRGGRG
REGQRGLQGTPGVPGDPGAEGAQGAEGLQGPQGLNGIPGRKGEKGSEGHKGPQGSPGPVG
VKGSIGAPGLLGKKGQPGILGVPGPVGQDGQRGKQGDHGIPGYGSIGRKGIKGPRGFPGD
MGQKGDAGDPGNPGRPGPKGSRGLTIHVGWKGEEGSRGDQGPPGRKGAKGMPGKSEYSQC
DLIKHIRTLSPCWKEKCPVYPTELVFALDQSYGITERRFNETRDIITSIVNDLDIRENNC
PVGARVVVVSYNSDTSYLIRHSDYRSKKQLLQLLSQIKYQIPTEARDLGNAMRFVARNLF
KRTYAGNNVRKVAVFFSNGEAASRSSIITATMEFSALDISPAVFAFNERNFLDEAFGFDK
TGTFQVIPVPPNGEYVPLERFRRCTLCYDKCFPNSCAKKVFFPENAYIDVAFLLDNSRNI
ASDEFKAMKALVISMLDNFNITSNPLTSDSGDRIALLTYSSGDSSRRKMGAVKPEFEFTT
YVKEDVMKSRIQTILQQLNGETTIGHALLWIMENLFPKTPNLRKHKAIFVVSAGENRERK
EFLTKMALRAKCQGYVIFVISLGSTHEDDMEELASYPLDHHLIQLGRIHKPDLDYIVKFS
KPFVYSIRREFNQYPPLMLDNACRLILSEEE
Download sequence
Identical sequences F7DNT5
9796.ENSECAP00000012260 ENSECAP00000012260 ENSECAP00000012260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]