SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012295 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012295
Domain Number 1 Region: 82-310
Classification Level Classification E-value
Superfamily L domain-like 9.07e-50
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 2 Region: 380-690
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.12e-43
Family Rhodopsin-like 0.00051
Further Details:      
 
Domain Number 3 Region: 10-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012295   Gene: ENSECAG00000014103   Transcript: ENSECAT00000015311
Sequence length 723
Comment pep:known chromosome:EquCab2:17:11005845:11078391:1 gene:ENSECAG00000014103 transcript:ENSECAT00000015311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYVLTDGSTITPLCQKGYFPCGNLTKCLPRAFHCDGMNDCGNGADEENCGDTSGWATIFG
TVHGNANNVALTQECFLNQYPQRCDCKETELECVNAGLKSVPTISSNVTLLSLKKNKIRS
LPNKVFVKYTELKKMYLQHNCIRHISRKAFFGLHNLQILYLNHNCITTLRPGVFKDLHQL
TWLILDDNPITSISQRLFTGLNSLFFLSMVNNHLEALPKQMCAQMPQLNWMDLEGNGIKY
LTNSTFLSCNSLTVLFLPRNQIDFVPEKTFSSLKNLGELDLSNNMIMELPPHIFKDLKLL
QKLKLASNPLLYLHKNQFESLKQLQSLDLERIEIPNINTGMFQPMKNLSHIYFKNFRYCS
YAPHVRICMPLTDGISSFEDLLANNILRIFVWVIAFITCFGNLFVIGMRSFIKAENTTHA
MSIKILCCADCLMGVYLFFVGFSDIKYRGQYQKYALLWMESLQCRLMGFLAMLSTEVSVL
LLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWIVGFLIAVIPFWNEDYFGNFYGKNG
VCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYIIMFCSIQKTALQTSEVRNHIG
REVAVANRFFFIVFSDAICWIPVFVVKILSLFRVEIPGTITSWIVIFFLPVNSALNPILY
TLTTSFFKDKLKQLLHKHRRKSIFKTKKKSLSTSIVWTDDSSSLKLGILNKITLGDSIVK
PIS
Download sequence
Identical sequences F7DJQ1
9796.ENSECAP00000012295 ENSECAP00000012295 ENSECAP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]