SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012311 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012311
Domain Number 1 Region: 192-437
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.04e-85
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 484-736
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-79
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 3 Region: 811-1045
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-62
Family Eukaryotic proteases 0.00067
Further Details:      
 
Domain Number 4 Region: 154-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012311   Gene: ENSECAG00000014457   Transcript: ENSECAT00000015328
Sequence length 1046
Comment pep:known chromosome:EquCab2:7:1173111:1195635:1 gene:ENSECAG00000014457 transcript:ENSECAT00000015328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTVGDLQLTPGATKEVPAPDAACCRAALSAVVATSIIVITLGALVASFSTQGVAVEHA
ARLGGLRYAASLQREGSAYHRALTAALQTLERELQRPPLETLSPGLEEELLQRGLRARLQ
GRGLPLAAYGTIVSAQLIGNQRGPPTDRDMKSGRCPADAFACGNSRCVTKVNPECDDSVD
CPDGSDEARCDCGLQPGWRTAGRIVGGVAASPGEFPWQVSLRENGEHFCGAAVVGARWLV
SAAHCFNEFQDPTEWVAYAGTTSLSGSEASTVRARVARIVTHPAYDSDTADFDVAVLELG
SPLPFSRHVQPVCLPAATHIFPPRRKCLISGWGYLKEDFLVKPERLQKATVELLDQALCA
GLYGPSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPG
VYARVTSLSNWILEAIATPSKPPAPTVAPAPATSSTAWPSSAESRGVDTPTPPMLAPSPV
PQDPVTASKPQECGVRPALEKPSRIVGGLGAAPGEVPWQASLEEGSRHFCGAAVVGDRWL
LSAAHCFNHTKVELVQAHLGTASLAGVGGSPVKMGLKRAVLHPQYDPGLLDFDVAVLELA
GPLVFNKYVQPVCLPLAVQKFPVGRKCMISGWGNTQEGNASKPDILQRASGIIDQKACSA
LYNFSLTDRMLCAGFLEGQVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGV
YSRVTRLKGWILDTMSSQPLPAPPPATMRTPATTSQAPRTTAGLTAPGVTASRPTPPATS
GATSQPANRTTTAMGTTTRGQTPLPHAPETTLGPQPPDCGLAPAAALTRIVGGSAAGRGE
WPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGADGQLER
VAGIHRHPFYNLYTLDYDVALLELPGPACRDGGPTLQAAARAPASHLPRVSMARQLQKEG
ERLLSKQTCRRFYSVQISRMLCAGFPQGGVDCSGDAGGPLACREPSGRWVLTGVTSWGYG
CGRPHFPGVYTRVAAVRGWIGQNIQE
Download sequence
Identical sequences F7D3L1
ENSECAP00000012311 ENSECAP00000012311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]