SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012321 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012321
Domain Number 1 Region: 69-145
Classification Level Classification E-value
Superfamily SEA domain 0.00000000418
Family SEA domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012321
Domain Number - Region: 29-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00111
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 1-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00129
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012321   Gene: ENSECAG00000014539   Transcript: ENSECAT00000015338
Sequence length 377
Comment pep:known chromosome:EquCab2:13:9008167:9020418:1 gene:ENSECAG00000014539 transcript:ENSECAT00000015338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLNGGTLSEEGCKCPPGFGGHQCQNRVPICWNNGTWDGLKCVCTSPYYGTSCEEVVSSLD
IAPTVSAQVELTVTVTNIGFSEELKDWSSQEFQDFNDTFTKQMEIVYSGIPEYEGVNITK
LSPGSVKVEHDVILKANFTPDYKDVLDKAIQDVESKIKTTTQEQISTNNTCETLLCFNET
ATRVQNISVTQYDPEEECREKAGQDFAEYFYVEYDDNGKPNCISRCEPNFNRSLNCNHGT
CQLDRSGPRCYCLITDTEWYSGETCEFSTKKSLVYGLLGAVGAVVLIILAILLMFIFRSR
RQVERQKSKVAQLYKWHEEDGGPAPGTFQNIGFDICEEQENYIRLDSIYSNFQPALGHID
SETKIRIKRPQVIMTSI
Download sequence
Identical sequences F7D387
9796.ENSECAP00000012321 ENSECAP00000012321 ENSECAP00000012321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]