SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012379 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012379
Domain Number 1 Region: 46-293,332-382
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.28e-45
Family SGL-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012379   Gene: ENSECAG00000014524   Transcript: ENSECAT00000015405
Sequence length 387
Comment pep:known chromosome:EquCab2:22:801993:823914:1 gene:ENSECAG00000014524 transcript:ENSECAT00000015405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLDSPIDPQPLSFKEPPLWLGVLQPNTKLR
QAERLFENQLTGPESIANIGDVMFTGTMDGRVVKLENGEVETIARFGSGPCKTRDDEPAC
GRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSEIPIEGRKMSFVNDLTITQDG
RKIYFTDSSSKWQRRDYLLLALEGTDDGRLLEYDTETKEVKVLLDQLRFPNGVQLSPAED
FVLVAETTMARIRRFYVSGLMKGGADLFVENLPGFPDNIRPSSSGGYWVGMATVRSNPGF
SMLDFLSERPYIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGQVVSYLS
EVHEQDGHLYLGSFRSPFLCRLSLQSV
Download sequence
Identical sequences F7CSZ7
ENSECAP00000012379 9796.ENSECAP00000012379 ENSECAP00000012379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]