SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012410 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012410
Domain Number 1 Region: 127-392
Classification Level Classification E-value
Superfamily vWA-like 1.33e-88
Family Trunk domain of Sec23/24 0.000000982
Further Details:      
 
Domain Number 2 Region: 8-66,409-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.72e-66
Family beta-sandwich domain of Sec23/24 0.00027
Further Details:      
 
Domain Number 3 Region: 621-761
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.17e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000511
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.59e-48
Family Helical domain of Sec23/24 0.00000733
Further Details:      
 
Domain Number 5 Region: 49-121
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.49e-21
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012410   Gene: ENSECAG00000014310   Transcript: ENSECAT00000015442
Sequence length 765
Comment pep:known chromosome:EquCab2:1:174976808:175026588:-1 gene:ENSECAG00000014310 transcript:ENSECAT00000015442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISEMNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences F7CB04
ENSECAP00000012410 XP_001492394.1.31192 XP_005603504.1.31192 XP_008517664.1.77740 XP_008517665.1.77740 XP_008517667.1.77740 XP_014699597.1.49734 XP_014699598.1.49734 XP_014699600.1.49734 ENSECAP00000012410 9796.ENSECAP00000012410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]