SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012413 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012413
Domain Number 1 Region: 253-336
Classification Level Classification E-value
Superfamily E set domains 5.6e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012413
Domain Number - Region: 343-390
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0785
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012413   Gene: ENSECAG00000014179   Transcript: ENSECAT00000015445
Sequence length 575
Comment pep:known chromosome:EquCab2:2:54511226:54695519:-1 gene:ENSECAG00000014179 transcript:ENSECAT00000015445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQDTLGRGPALKEKSLGTEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
TEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPV
IIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHA
IRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGD
PERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQIPALSSSPA
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMN
GYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKS
AFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM
Download sequence
Identical sequences F7CAY5
ENSECAP00000012413 XP_001493993.1.31192 XP_008533955.1.77740 XP_014700892.1.49734 9796.ENSECAP00000012413 ENSECAP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]