SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012762 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012762
Domain Number 1 Region: 396-744
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.43e-86
Family YicI catalytic domain-like 0.0000605
Further Details:      
 
Domain Number 2 Region: 746-828
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.39e-22
Family Putative glucosidase YicI, domain 3 0.0079
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000691
Family YicI N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012762   Gene: ENSECAG00000014477   Transcript: ENSECAT00000015836
Sequence length 966
Comment pep:known chromosome:EquCab2:12:22903208:22917476:-1 gene:ENSECAG00000014477 transcript:ENSECAT00000015836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRSWTGLVLACLGVLLGISLAVDRSNFKTCEESSFCKRQRSVRPGLSPY
RALLDSLQLGPDALTVHLMNEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPTARLSISGRDDNSVELTVAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLHFEH
QRAPRVSFSDKVSLTLGSIWDKIKNLFSRQGSKDPAEGDGAQPEETPGDGDKAKETQGRA
DKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYR
LYNLDVFQYELYNPMALYGSVPVLLAHSPHRDLGIFWLNVAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDVRWMSESGIIDVFLLLGPSVFDVFRQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHADGKRYFTWDPSRFPQPLTMLEHLAS
KRRKLVAIVDPHIKVVSGYRVHEELQNQGLYVKTRDGSDYEGWCWPGAAGYPDFTNPTMR
AWWANMFSFENYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGFY
VHMATADGLVQRSGGIERPFVLSRAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGL
VGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFYRAHAHLDTGRREPWLLPSQYHDMVR
DALNQRYSLLPFWYTLFYQAHREGIPVMRPLWVNFPQDVTTFSIDDQFLLGDALLVHPVS
DAGARGVQVYLPGEGEVWYDIESYQKHHGPQTLYLPVTLSTIPVFQRGGTIVPRWMRVRR
SSECMKDDPITLFVALSPQGTAQGELFLDDGHTFSYQTHNEFLLRRFSFSGNTLVSSSAD
PKGHFETPIWIERVVIIGAGKPAAVVLQTKGSPETRLSFQHDPETSVLILRKPGVNVASD
WSIHLQ
Download sequence
Identical sequences F7C4H8
ENSECAP00000012762 ENSECAP00000012762 9796.ENSECAP00000012762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]