SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012776 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012776
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily E set domains 3.01e-69
Family Arrestin/Vps26-like 0.0000000662
Further Details:      
 
Domain Number 2 Region: 188-392
Classification Level Classification E-value
Superfamily E set domains 4.48e-63
Family Arrestin/Vps26-like 0.0000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012776   Gene: ENSECAG00000014255   Transcript: ENSECAT00000015852
Sequence length 400
Comment pep:known chromosome:EquCab2:6:20211053:20239554:1 gene:ENSECAG00000014255 transcript:ENSECAT00000015852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASMKTSRATPNRVIFKKTSRDKSVTIYLGKRDYIDHVDQVEPVDGVVFVDPELVKGKK
VYVSLTCAFRYGQEDIDVMGLTFRRDLYFSRVQAFPPVGAAGTHTKLQESLIKKLGGNTY
PFLLTFPDYLPCSVMLQPAPQDTGKSCGVDFEVKAFATDSTDGEEDKTPKKSSVSLLIRK
VQHAPPKMGPQPRAEAAWQFFMSDKPLHLAVSLSKEIYFHGEPIPVTVTVTNNTEKTVKK
IKALVEQVANVVLYSSDYYVKPVATEETQEKVPPNSTLTTTLTLVPLLANNRERRGIALD
GKIKHEDTNLASSTIVKEGIDRTVMGILVSYQIKVKLMVSGFLGELTSSEVATEVPFRLM
HPQPEDPGQSRCQDENLVFEEFARQNLKDAGEMEERKKHQ
Download sequence
Identical sequences F7C439
9796.ENSECAP00000012776 ENSECAP00000012776 ENSECAP00000012776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]