SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012820 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012820
Domain Number 1 Region: 10-139
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-21
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012820   Gene: ENSECAG00000015219   Transcript: ENSECAT00000015902
Sequence length 141
Comment pep:known chromosome:EquCab2:21:3689425:3690627:-1 gene:ENSECAG00000015219 transcript:ENSECAT00000015902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPDTVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVILEFPQRVCVS
QLQIQFQGGFSSRRGCLEGSQGSEALGKIVDFYPEDNNSLQISCPSLWAADVDRLKVTFE
DATDFFGRVVIYHLRVLGEKV
Download sequence
Identical sequences F7DVT0
9796.ENSECAP00000012820 ENSECAP00000012820 ENSECAP00000012820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]