SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012889 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012889
Domain Number 1 Region: 1218-1345,1533-1719
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily Sema domain 1.26e-20
Family Sema domain 0.015
Further Details:      
 
Domain Number 3 Region: 776-868
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000121
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 4 Region: 684-779
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000267
Family Other IPT/TIG domains 0.0097
Further Details:      
 
Domain Number 5 Region: 97-148
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000128
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 866-910,940-993
Classification Level Classification E-value
Superfamily E set domains 0.0000000000358
Family Other IPT/TIG domains 0.06
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012889
Domain Number - Region: 1007-1058
Classification Level Classification E-value
Superfamily E set domains 0.0098
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 
Domain Number - Region: 643-684
Classification Level Classification E-value
Superfamily Plexin repeat 0.0103
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 253-285
Classification Level Classification E-value
Superfamily Plexin repeat 0.0131
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012889   Gene: ENSECAG00000014767   Transcript: ENSECAT00000015985
Sequence length 1752
Comment pep:known chromosome:EquCab2:16:38517461:38543240:1 gene:ENSECAG00000014767 transcript:ENSECAT00000015985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRVPLEATPVLEWPGVQLTAVAVTMEDGHTIAFLGDSQGQLHRVFLGPGSDGHPYSTQ
SIQQGSAVSRDLTFDGAFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLL
GRCSRRSECSRGQGPERWLWSFQPELGCLQVADMSPANMSREERREVFLSVPDLPPLWPG
ESYSCHFGEHQSPALLTSSGVMCPSPDPSEAPALPRGDDHVSVSVELRFGTVMIAKASLS
FYDCVAVTKLRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVVSQQSLLLSPAPP
AGVAPTPLPPAAPKATVIPAPDTLPVERDAPSTATASDIPPRARPSLLSPWGPWAGPGPI
PASASTESPLHEELPPPSPPNRPGTTVTVPTDFGPMATPEDLLASHLTPSDAAALPPAPA
DPGPEALPSVIPLDQHPGTAPATTFPGATGSTKPALDWLMREVGELPEADEWTGGDTPAF
STSTLLSGDGDSAEHEGPPAPLILLSSLDYQYDTPGLWELEEVTWGASSCPCVESIQGSM
LMPVHVEREVRLLGRNLHLFQDSPGDNECVMELEGHEVVVEAQVKCEPPPDTRCHVTCQQ
HQLSYEALQPELRVGLFLRRAGHLRVDSADGLHVVLYDCSVGHEDCSRCQTAMPQYGCVW
CKGERPRCVAQEACAEAEAVATKCPAPLIHSVEPLTGPIDGGTRVTIRGSNLGQHVQDVQ
DTVRVAGIPCAVDAREYEVSSSLVCITEASGEEVADAVTVEVPGRGRGISEHDFAYQDPK
VHSIFPARGPRAGGTRLTLHGSKLLTGRLEDIRVVVGDQPCHLLLEQQAEQLQCETSPHP
APAMLPVAVWFGATERRLQHSQFEYTSDPNITSAGPTKSFLSGGREIWVHGQNLDVVQTP
RIRVTVALRALQLSQGLGRRRRVIPETPCSPGASCGSHHFEEPCHVNSSQLITCRTPALP
VLPEDPWVRVEFILDSLVFDFATLNPTPFSYEADPTLQPLNPEDPTTPFRHKPGSVLSVE
GENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVDQPLPRHHALREAPDTLPEFTV
QMGNLRFSLGHVQYDGESPMAFPMAAQVGLGVGTSLLALGVVIIVLMYRRKSKQALRDYK
KVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERVFFPGHQES
PLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTV
ALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSV
GEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGE
AQGVPVKVLDCDTISQAKEKMLDQLYKGMPLAQRPDPRTLDVEWRSGVAGHLILSDEDVT
SEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDIDEGGIRP
WHLVKPSEEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILST
SRPVPLAVKYFFDLLDEQAQQHGISDQDTVHIWKTNSLPLRFWINIIKNPQFVFDVQTSD
NMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKRMVERYYADIRQTIPAS
DQEMNSILAELSRNYSGDLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQ
IAAAVENKVTDL
Download sequence
Identical sequences F7DM69
ENSECAP00000012889 9796.ENSECAP00000012889 ENSECAP00000012889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]