SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012957 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012957
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-64
Family Calnexin/calreticulin 0.00014
Further Details:      
 
Domain Number 2 Region: 175-289
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.72e-42
Family P-domain of calnexin/calreticulin 0.00000501
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012957
Domain Number - Region: 280-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0823
Family Calnexin/calreticulin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012957   Gene: ENSECAG00000015205   Transcript: ENSECAT00000016061
Sequence length 360
Comment pep:known chromosome:EquCab2:2:7678982:7698646:1 gene:ENSECAG00000015205 transcript:ENSECAT00000016061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTPIDGWKKRWVESKHRPDYGKFQLTAGKFYGDKEKDKGLQTSEDAKFYALSTRFGPFSN
ENETLVVQFSVKHEQGIDCGGGYVKLFPDTLNQEDMHSESEYYVMFGPDICGFGNNKVQV
ILRYQGKYHENNKTIKCRINKDTHLYTLIIRPNATYEVKIDNQQVAAGDLEDDWDFLPPR
KIKDPYARKPRKWDERLQIEDPEDKKPEDWEDFEYIPDPDAKKPDDWNEEMDGEWEGPLI
PNLNYKGQWKPRIIDNPNYQGEWIHPEIDNPKYKPDLTICHYYNISVLGLDLWQVKSGSI
FDNFLLTNDEEFAEEVGNKTWGIRKDVETQWRELYEEMEKRKQEEEAEKTKEKEEEREDD
Download sequence
Identical sequences F7D0R5
ENSECAP00000012957 9796.ENSECAP00000012957 ENSECAP00000012957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]