SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012958 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012958
Domain Number 1 Region: 217-289
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.0000301
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily PX domain 0.000000000000445
Family PX domain 0.0000438
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000012958
Domain Number - Region: 149-189
Classification Level Classification E-value
Superfamily SH3-domain 0.000801
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012958   Gene: ENSECAG00000015095   Transcript: ENSECAT00000016064
Sequence length 299
Comment pep:known chromosome:EquCab2:13:12175860:12191950:1 gene:ENSECAG00000015095 transcript:ENSECAT00000016064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDTFIRHIALLGFEKRFVPSQHYVYIFLVKWQDLSEKVVYRRFTEIYEFHVSYKRIPLG
VDGGQTRVEGRLIVIIQAWWRWGCFARKARSITLDLPVAFNWLPLYSRYPHLCQFFSLRP
RGRKLAANCPVKKPETYLMPKDGKNNIGDITGPIILQTYRAIADYEKTSGSEMALAGDVL
DVVEKSESGQPPRPAWQPRGLLPGMSLCGVPAPSRADCHPHTAGEPYVTIKAYIAALEDE
VSLEEGETIEVIHKLLDGWWVIRKDDVTGYFPSMYLQKAGQDVAQAQRQIKSRGAPPRR
Download sequence
Identical sequences F7D0Q8
ENSECAP00000012958 ENSECAP00000012958 9796.ENSECAP00000012958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]