SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013072 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013072
Domain Number 1 Region: 453-740
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-82
Family Protein kinases, catalytic subunit 0.000000000136
Further Details:      
 
Domain Number 2 Region: 949-1087
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.83e-59
Family FAT domain of focal adhesion kinase 0.000000187
Further Details:      
 
Domain Number 3 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.99e-40
Family First domain of FERM 0.00000245
Further Details:      
 
Domain Number 4 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 5.23e-39
Family Second domain of FERM 0.000000439
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-37
Family Third domain of FERM 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013072   Gene: ENSECAG00000014150   Transcript: ENSECAT00000016200
Sequence length 1093
Comment pep:known chromosome:EquCab2:9:79818506:80002758:-1 gene:ENSECAG00000014150 transcript:ENSECAT00000016200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYLDPNLNHTPNSSTKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSERQGVRTHAVSVSGVSHCQHKVKKARRFLPLVFCSLEPPST
DEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQG
VYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIM
ELCTLGELRSFLQVRKYNLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDC
VKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHG
VKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTI
LEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQT
NHYQVSGYPGSHGVTAVAGSIYPAQASLLDQTDSWNHRPQEISMWQPNVEDSAALDLRGI
GQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQH
IYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKLQPQEISPPPTANLDR
SNDRVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPAST
HREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVID
QARLRMLGQTRPH
Download sequence
Identical sequences F6U9I3
9796.ENSECAP00000013072 ENSECAP00000013072 ENSECAP00000013072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]