SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013121 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013121
Domain Number 1 Region: 14-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-45
Family Galectin (animal S-lectin) 0.00014
Further Details:      
 
Domain Number 2 Region: 221-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-41
Family Galectin (animal S-lectin) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013121   Gene: ENSECAG00000015230   Transcript: ENSECAT00000016253
Sequence length 357
Comment pep:known chromosome:EquCab2:1:75031967:75049684:-1 gene:ENSECAG00000015230 transcript:ENSECAT00000016253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLNNLQNVISNPIIPYVGTIPEQLEPGTLIVVRGHVPNDSDRFQVDLQCGSSVKPRAD
VAFHFNPRFKRSNCIVCNTLKNEKWGWEEITYDMPFKKERSFEIVFMVLKDKFQVAVNGK
HILLYAHRISPEKIDTLGISGKVNIHSVGFSFSSDLRSTQASTLELTEISRENVQKSGMS
QFPSNRGDISKIVPRTVYTKSKGSTASHTLTCAKILRTNCWSKTLPFVARLNSSMGPGRT
IVVKGEVNTNAKSFNVDLKSGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFP
FSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDMLEIDGDIHLLEVRSW
Download sequence
Identical sequences F6TMY5
9796.ENSECAP00000013121 NP_001296264.1.31192 ENSECAP00000013121 ENSECAP00000013121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]