SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013133 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013133
Domain Number 1 Region: 40-251
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.08e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000443
Further Details:      
 
Domain Number 2 Region: 538-756
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-61
Family Ankyrin repeat 0.0000185
Further Details:      
 
Domain Number 3 Region: 247-379
Classification Level Classification E-value
Superfamily E set domains 4.43e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 4 Region: 804-885
Classification Level Classification E-value
Superfamily DEATH domain 5.77e-16
Family DEATH domain, DD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013133   Gene: ENSECAG00000015042   Transcript: ENSECAT00000016267
Sequence length 971
Comment pep:known chromosome:EquCab2:3:37317740:37407632:-1 gene:ENSECAG00000015042 transcript:ENSECAT00000016267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDDPYLGGHEQMFHLESLNHTMFNPELFTQEVSLPTDGPYLQILEQPKQRGFRFRYVC
EGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKFVQLVTNGKHTHLHGSQSSGKNTVKDG
ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACVRGYNPEILVHPDLRYLQAE
GGGDRQLTDREKEVIHQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYD
SKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDFS
PTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR
KRQKLMPNFSDSFGGGSGAGAGGGGMFGGGGGGGGAGSTGPGYGFPHYGFPTYGGITFHP
GAAKSNAGMKHGTIDTSCKNDPEGCDASDDREAVNLSGKGTETTARKDGSRGRALLLSGV
CVMGLGHPSHCLADNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGD
SVLHLAIIHLHAQLVRDLLEVTSGLVSDDIINMRNDLYQTPLHLAVITKQEAVVEDLLRA
GADLSLLDRFGNSALHLAAKEGHDKILGILLKHKKAALLINHPNADGLNAIHIAMMSNSM
PCLRLLVTAGADVNAQERKSGRTALHLAVERDNISLAGCLLLEGEAHVDSTTYDGTTPLH
IAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEENGEDEGVVPGTTPLDMATSWQV
FDILNGKPYEPEFTSDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGLGIL
NNAFRLSPAPSKTLMDNYEVSGGTIKELVDALRQMGYTEAVEVIQAAFCTSGTAAPSPVT
TTSQAPLLPLAPASTRQQIDELREDSVCDSGVETSFRRLSFTESLTSGSSLLTLNKMPHD
YMQEGPIEGKI
Download sequence
Identical sequences F6TME6
9796.ENSECAP00000013133 ENSECAP00000013133 ENSECAP00000013133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]