SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013202 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013202
Domain Number 1 Region: 319-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000017
Further Details:      
 
Domain Number 2 Region: 157-317
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.65e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000407
Further Details:      
 
Domain Number 3 Region: 120-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000095
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 77-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000225
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 22-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013202   Gene: ENSECAG00000015388   Transcript: ENSECAT00000016344
Sequence length 481
Comment pep:known chromosome:EquCab2:14:82193689:82572269:1 gene:ENSECAG00000015388 transcript:ENSECAT00000016344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSVAAWLLLGLTLCVPQFCKGDICDPNPCENGGVCLPGVAEGSFSCECPGGFTDSNCS
SIVEVASDEEEPPTTAGPCTPNPCHNGGTCERSEAYRGDTFIGYVCKCPRGFKGVHCQHN
INECEAEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASST
HRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGS
PEYIKSYKIAYSSDGKTWAMYKGKSTFKDVVFHGNVDNNTPYANSFTPPIKAQYVRLYPQ
VCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLD
KQGKVNAWNSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSDDGEHW
TVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCKEE
E
Download sequence
Identical sequences F6VKK6
9796.ENSECAP00000013202 ENSECAP00000013202 ENSECAP00000013202 XP_001504684.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]