SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013298 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013298
Domain Number 1 Region: 136-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000977
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 107-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000439
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013298   Gene: ENSECAG00000015593   Transcript: ENSECAT00000016463
Sequence length 193
Comment pep:known chromosome:EquCab2:25:37314146:37470438:-1 gene:ENSECAG00000015593 transcript:ENSECAT00000016463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSRELLLVWFLVLAVGGTQHIYRPGRRVCAIGVPRGPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGPAPARPRYACCPGWKRTSGLPGACGAAVCQPPCQNGGVCVQP
GRCHCPAGWRGDTCQTDVDECSAGRGGCPQRCVNTAGSYWCQCWEGHSPSADGAICLPKR
GTARVPHPPRSGQ
Download sequence
Identical sequences F6V4N1
ENSECAP00000013298 9796.ENSECAP00000013298 ENSECAP00000013298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]