SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013401 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013401
Domain Number 1 Region: 348-521,555-719
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.93e-87
Family YicI catalytic domain-like 0.00084
Further Details:      
 
Domain Number 2 Region: 103-346
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.28e-43
Family YicI N-terminal domain-like 0.0051
Further Details:      
 
Domain Number 3 Region: 722-818
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-16
Family Putative glucosidase YicI, domain 3 0.0052
Further Details:      
 
Domain Number 4 Region: 78-131
Classification Level Classification E-value
Superfamily Trefoil 0.00000000126
Family Trefoil 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013401   Gene: ENSECAG00000015401   Transcript: ENSECAT00000016588
Sequence length 951
Comment pep:known chromosome:EquCab2:11:2834444:2849396:-1 gene:ENSECAG00000015401 transcript:ENSECAT00000016588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRRLPCSRPLGLCVLVCLATAALLGHVLLHDFTMVPRELHGFSQVPKEIYRAPQQGAS
GPGPQPAPGRRGSPRAAPAQCDTPPDSRFDCAPDKAITQEQCEARGCCYVPARRQPPGSQ
MGQPWCFFPPSYPSYKLGNLTTTEMGYTATLTRAAPTFVPKDILTLRLDVLVETESRLHF
TIKDPANRRYEVPLETPRVRSRATSTLYSVEFSEEPFGVVVRRKLNGRVLLNTTVAPLFF
ADQFLQLSTSLPSRYVTGLAEHLGPLMLNTNWTKITLWNRDIAPTPSVNLYGSHPFYLVL
EDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLEVVGYP
FMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGF
GDFPAMVQELHQGGRRYMMIVDPAISSSGPPGSYRPYDEGLRRGVFITNETGQPLIGKVW
PGSTAFPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLENP
PYVPGVVGGTLRAATVCASSQQFLSTHYDLHNLYGLTEAIASHRALVKARGVRPFVISRS
TFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRW
TQLGAFYPFMRNHNGLDSLPQEPYRFSETAQQAMRKAFALRYMLLPHLYTLFHGAHTRGQ
TVARPLFLEFPEDPRTWTVDRQLLWGEALLITPVLEAGRVEVTGYFPLGTWYDLQTVPVG
ALGGLPSPAPAPLMPAIHSEGQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRKQPM
ALVVALTSSREAQGELFWDDGESLGVLEREAYTHIIFLARNNTIINELLHVTSEGASLQL
ERVTVLGVAVAPQQVLSNGVPVSNFTYNPDTKTLDIPVSLTMGEQFLISWS
Download sequence
Identical sequences F6W5W1
ENSECAP00000013401 9796.ENSECAP00000013401 XP_005597129.1.31192 XP_005597130.1.31192 XP_005597131.1.31192 XP_005597132.1.31192 ENSECAP00000013401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]