SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013532 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013532
Domain Number 1 Region: 1737-1983
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 1053-1186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 854-984
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 329-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000847
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 511-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 699-832
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 674-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 449-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 9 Region: 177-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 63-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000055
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 208-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000753
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 99-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 13 Region: 1181-1225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.006
Further Details:      
 
Domain Number 14 Region: 1293-1333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000368
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 15 Region: 633-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000554
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 1222-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000732
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 1341-1373
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0015
Further Details:      
 
Domain Number 18 Region: 27-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 981-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 1420-1451
Classification Level Classification E-value
Superfamily Notch domain 0.000000288
Family Notch domain 0.0034
Further Details:      
 
Domain Number 21 Region: 139-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000499
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 22 Region: 488-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000013532
Domain Number - Region: 1383-1414
Classification Level Classification E-value
Superfamily Notch domain 0.00123
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 1035-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.037
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 3-20
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0383
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 834-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013532   Gene: ENSECAG00000015266   Transcript: ENSECAT00000016738
Sequence length 2273
Comment pep:known chromosome:EquCab2:5:49575714:49725904:1 gene:ENSECAG00000015266 transcript:ENSECAT00000016738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGKATCRCALGFTGEDCQYSTTHPCFVSHPCLNGGTCHVLSRDAYECTCQVGFTGKLCQ
WTDACLSHPCANGSTCTTVANQFSCKCLGGFTGQKCETDVNECEIPGQCQHGGTCLNLPG
SYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPVYEGNTCERNIDD
CPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYG
CVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNP
CHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCE
CLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPC
VNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFT
GVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCI
DLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGVCMDGVNRYSCVCSPGFTGQRCNIDI
DECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKC
LCEAGWVGINCEVDKNECFSNPCQNGGTCDNLVNGYRCTCKKGFKGFNCQVNIDECASNP
CLNQGTCFDDISGYTCQCVLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESYTCLCAP
GWQGQRCTIDIDECVSKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNG
GSCVDGVNTFSCLCLPGFIGDKCQTDMNECLSEPCKNGGTCSDYVSSYTCKCQAGFDGIH
CENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECNSHPCLNEGRCVDG
LGTYRCICSLGYTGKNCQTLVNLCSRSPCKNQGTCIQEKAESRCLCPSGWAGAYCDVPNV
SCEVAADRRGVPVDRLCQHSGICISAGNSHHCQCPLGYTGSYCEEQLNECSSNPCQHGAT
CSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCE
DNIDDCAGGPHCLHGGQCVDRIGGYSCRCLPGFAGERCEGDINECLSSPCSSEGSLDCIQ
LINDYLCVCHRAFTGRHCETFIDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQ
SSCGQVKCRRGEQCVHTASGPRCFCPNPQDCESSCASNPCQHGGSCYPQRQPPYYSCQCS
PPFWGSRCELYTAPTSTPPDTCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPW
ANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCN
SEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLRQDARSFLRALGTLLHTNLRIKRDS
QGGLMVYPYYGEKSAVVKKPRMTRRSLPSDEEQEVAGSKVFLEIDNRQCVQDSDQCFKNT
DAAAALLASHAIQGTLSYPLVSVVSESLTPKRTQLLYLLAVAVVIILFIILLGVIMAKRK
RKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEG
PQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNV
RGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHL
AARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMND
GTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANR
DMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLD
EYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMGKKPRRPNAKSAMPTSLPNLAKET
KDAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPM
LATAAPPAPVHAQHALSFSNLHEMQPLSHGASTVLPSVSQLLSHHHIVPPGNGSAGSLGR
LHPVTVPADWMNRMEMNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPP
IVTFQLIPKAVLPSQLGLPSLSPTALLLLQAPCPPCTRFQKWLVCPVWHSPLP
Download sequence
Identical sequences F6UL72
ENSECAP00000013532 ENSECAP00000013532 9796.ENSECAP00000013532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]