SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013569 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013569
Domain Number 1 Region: 915-1215
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.14e-83
Family Complement components 0.0000467
Further Details:      
 
Domain Number 2 Region: 1297-1402
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.27e-34
Family Alpha-macroglobulin receptor domain 0.00011
Further Details:      
 
Domain Number 3 Region: 745-864
Classification Level Classification E-value
Superfamily E set domains 9.24e-17
Family SVA-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013569   Gene: ENSECAG00000015784   Transcript: ENSECAT00000016780
Sequence length 1404
Comment pep:known chromosome:EquCab2:6:36432491:36473173:-1 gene:ENSECAG00000015784 transcript:ENSECAT00000016780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYILWISSVMQSHSTEKACLHLLNLNESVSLSVVLEYDGFNTTIFDQSVEEDNFYACANF
KVSQKSSEQLAFVTLLAKGDTLKIFERRSLALASEETVTFVQTDKPIYKPGENVQVRIVT
LDTKFIPIEDLFPLITLQDPQNNRIFQWRNVTSFQNITQLSFQLTSEPMFGDYSLAVKRN
SEKMLTHQFTVDRYVLPKFEVKVSVPQTVTISDDEFQVDACAKYTYGQPVQGKAEIWVCR
EFAYSRNCENDNNEICEQFIGVMYLNGCVSQIVNTKVFQLYRSGFFMSFYVTATVTEIGT
GVQISEKSSISITQLLGSVNFENMDPFYRRGISYFGTLKFSGPNNIPMVNKLLQLELNDK
FIGNYTTDENGEAQFSIDTSNIFDPEFNLKATYIRPKSCYLPSWLTPEYMDAHFSVSRFY
SRTNSFLKIVPEPKQLRCNERKIVTVHYSLNSEAYRDNSNINFFYLIMVKGAIFLSGQKE
IRNKDWNGNFSFPINISTDLAPVAFVLVYTLHPSGEIVADSVRFQVDKCFKNKVSIKFSK
EQGLPGSNTSLYLQAAPDSFCALRAVDKSVLLLKSEQQLSAESVYNLLPNIELYGYFYHG
LNLDDGKLDPCIPQKDMFYNGLYYIPVSNNGDGDIADIIRIMGLKVFTNLHYRKPEVCST
ERMMPFPRPLYLGIKDYAPMYKRAMMETVRTYFPETWIWDLVSVDSSGSANLSFLIPDTI
TQWEANGFCVNGDAGFGISSTTTLEVSQSFFVEMTLPFSVVRNERSDLIVNIFSYLNTCV
EISVQLEPSPVFEANISTPKNNGSEVIQAGERKTYVWTLTPKKLGKVNITVVAESKQSSA
CPDEASAQQNPNWKDTVIKSLLVEPEGIEKEMTQSFLICTKGAKASKQVVLDLPDNVVEE
SARAFFTVVGDILGLTMQNLENLLQMPYGCGEQNIALVASDTYVLDYLKATKQLTEEVKS
KAFFFLSNGYQKQLSFKNSDGSYSVFWQRNQKGSLWLSALTFKTLERMKKYVFIDEQVQK
QTLIWLSSQQRSNGCFKSDGKLFNNAWEGGDEEDILLTAYIVGAFLEAGLNFTFPALRNG
LFCLEEALENGVTNGYNHAILAYAFALAGKEEQVESLLQILDQSSTKINDVIYWERAKKP
KTEASPSFIPRAPSAETEKTCYVLLAVISRKTPDLTYASKIVQWLAQQMNSHGGFSSTQD
TAVCLLAITRYVVLTFSKDQNTVTISSEESNEIFQVNGDNRLLVQHSELTKARGQYTVDV
EGQGCTFIQATLRYNVLLPKEASGFFLSLEMVKKNSSDMFQSNFDLTVTLRYTGIRNNSN
MVLVDVKMLSGFTPVMASIEELENNGQVMKTEVKNDHVLFYLENVFGTANSFTFSVEQSN
LVSNIQPALALVYDYYEKGRQALL
Download sequence
Identical sequences F6UDZ6
ENSECAP00000013569 9796.ENSECAP00000013569 ENSECAP00000013569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]