SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 69_2 > ENSECAP00000013570

Domain assignment for ENSECAP00000013570 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000013570
Domain Number 1	Region: 90-221
Classification Level	Classification	E-value
Superfamily	YWTD domain	0.00000000000000445
Family	YWTD domain	0.0033
Further Details:

Domain Number 2	Region: 40-79
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000000247
Family	EGF-type module	0.0051
Further Details:

Domain Number 3	Region: 9-50
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000363
Family	EGF-type module	0.022
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000013570 Gene: ENSECAG00000016035 Transcript: ENSECAT00000016781
Sequence length	223
Comment	pep:known chromosome:EquCab2:18:24455568:24516693:-1 gene:ENSECAG00000016035 transcript:ENSECAT00000016781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LLPSCQQLNCQYKCAMIRNSTRCYCEDGFEVKEGGRSCKDQDECAIYGTCSQTCINTYGS YACSCVEGYIMQPDNRSCKVKNEPTDGPPMLLIANSETIEVFYLNGSKMATLSSVNGNEI HTVDFIYNEDTICWIESRESSNQLKCIQITKTERLTDEWTINILQSFHNVQQMAIDWLTR NLYFVDHVSDRIFVCTYNGSVCVTLIDLELHNPKAIAVDPIAG
Download sequence
Identical sequences	F6UDP8 9796.ENSECAP00000013570 ENSECAP00000013570 ENSECAP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]