SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013570 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013570
Domain Number 1 Region: 90-221
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000445
Family YWTD domain 0.0033
Further Details:      
 
Domain Number 2 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000247
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013570   Gene: ENSECAG00000016035   Transcript: ENSECAT00000016781
Sequence length 223
Comment pep:known chromosome:EquCab2:18:24455568:24516693:-1 gene:ENSECAG00000016035 transcript:ENSECAT00000016781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPSCQQLNCQYKCAMIRNSTRCYCEDGFEVKEGGRSCKDQDECAIYGTCSQTCINTYGS
YACSCVEGYIMQPDNRSCKVKNEPTDGPPMLLIANSETIEVFYLNGSKMATLSSVNGNEI
HTVDFIYNEDTICWIESRESSNQLKCIQITKTERLTDEWTINILQSFHNVQQMAIDWLTR
NLYFVDHVSDRIFVCTYNGSVCVTLIDLELHNPKAIAVDPIAG
Download sequence
Identical sequences F6UDP8
ENSECAP00000013570 ENSECAP00000013570 9796.ENSECAP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]