SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013738 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013738
Domain Number 1 Region: 910-1077
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-44
Family C-type lectin domain 0.00000561
Further Details:      
 
Domain Number 2 Region: 118-229
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-38
Family Link domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1078-1138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000118
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 875-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 5 Region: 11-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000038
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013738   Gene: ENSECAG00000016115   Transcript: ENSECAT00000016969
Sequence length 1186
Comment pep:known chromosome:EquCab2:21:3701690:3720921:1 gene:ENSECAG00000016115 transcript:ENSECAT00000016969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TENGLHMQKVGSGSVRAALAELVALPCLFTLRPQQSAAREAPRIKWTKVRTASGQRQDLP
ILVAKDNVVRVAKGWQGRVSLPAYPRHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDL
VPLEVTGVVFHYRAAQDRYALTFAEAQEACRLSSATIAAPRHLQAAFEDGFDNCDAGWLS
DRTVRYPITQSRPGCYGDRRSLPGVRSYGRRDPRELYDVYCFARELGGKTPPSLSPYYPA
HPSSIPNQDPGPRLPSLPSLHEPLLSAPVSLPAPIPFPTPLLLSEAPSPSPSLSLKTDSL
RSLSYLFCKKKLKIPLSNAWEVTTTCSGKGGRTAAAVAALFSHHPNPARSGLFGVAPPSR
ALEEGPPGPSDLHDCGAGYTPEIPHIAVDHTEIRRCLETTFLLSLEKNAPDRILMTVVDL
VAGSLGGRSPPEPWLWPPTVAPPSIPGPSRALGLELEEVEGPSVRPATPNLPWSPLEATA
LEGPSTIPWEAPPMISSPDLPVVAMLRAPKLGLLPHPTPFTTQANGIKRHGEAMVTAPPS
PASEIEASPQDPIHPELTGWRGHILNTHPNSPRADLGETGGTSPTGLSKAEHPRSSPQAS
VDGNEVVDFAPTETATEPTGVTGILGSESGVFSTAESPTFSSQATVDEAQGTWPSLHSGG
LDLHPPFASSGGPGVSLMPRVTPSLEPWAATEATVGPTDSVATLGPRNAGGIWDSGSYAV
EGADSPTLSLQVAVDTSVVTSLMSLDPGDKVRVLAMSTVAFSNSQSHLELEGQMVTQGTL
GASAPRHEGSPLGEPTFPPWTPTAASMDEPVSVSSGEPTVPWDSHSTLLPASLGPDEFEL
EVLASSPGVEGFWEEAASGEEPALPGTPANGTLSDPCENNPCLHGGTCKANGTMYGCSCD
QGFTGENCEIDIDDCVSSPCENGGTCIDEVNTFICLCLPSYGGSLCEKDTEGCDRGWHKF
QGHCYRYFAHRRAWEDAERDCRHRAGHLTSIHSPEEHGFINSFGRENTWIGLNDRIVERD
FQWTDNTGLQYENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGTVLC
GPPPTVENASPIGARKAKYNVHATVRYQCDEGFAQRHVAIIRCRSNGKWDRPQIVCTKPR
RSHRMRRHHHHHQHHHQHRHHKLRKERRKHKKHPAEDWEKEEGNFC
Download sequence
Identical sequences F6V964
ENSECAP00000013738 ENSECAP00000013738 9796.ENSECAP00000013738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]