SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013781 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013781
Domain Number 1 Region: 2191-2472
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000127
Further Details:      
 
Domain Number 2 Region: 666-774
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 1352-1458
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-28
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 776-882
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 1075-1183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-27
Family PDZ domain 0.007
Further Details:      
 
Domain Number 6 Region: 1786-1875
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1493-1598
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-21
Family PDZ domain 0.039
Further Details:      
 
Domain Number 8 Region: 1878-1971
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-17
Family PDZ domain 0.031
Further Details:      
 
Domain Number 9 Region: 581-665
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000134
Family First domain of FERM 0.017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000013781
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000642
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013781   Gene: ENSECAG00000015663   Transcript: ENSECAT00000017016
Sequence length 2487
Comment pep:known chromosome:EquCab2:3:50840317:50988246:-1 gene:ENSECAG00000015663 transcript:ENSECAT00000017016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEELWAVLNQSAESLQELFRKVSIADPAALGFVISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNL
SGTDQLARNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIHKSPFSHQTFLNKGLSKS
MGFLSIRDTQDEEDYFKDISSDNNSGHEDCENTCSPYQFKTSGPGKKATPGIDVLPKKKI
WASSMDLLCTADRDFSSGETGRYEHCLPETVTVRTSTTPRKKEARYSDGSIALDIFGPQK
MDPLFHTRELPISSAISSALDRIRERQKKLQVLREAMNVEEPIRRYKTYHSDIFSTSSES
PSIISSESDVRQVRKSEASKRFESNTGLPGVDETPSQGQSQRPSRQYETSLEGNLINQEI
MLKRQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDITRDPLREMALETAMTQRKLRNF
FGPEFVKMTIEPFISLDLPQSILVSNKSNLTRDNRRKVKHFLSGQRELTCDTKTICEDVL
DMGVAHIGLVERWFALATLKDNEYFFVDPDLKLTKVAPDGWKEEPKKKSKATVNFTLFFR
IKFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVH
GVSYFRLEHYLPPRVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVH
FHRVHPEKKSQTGILLGVCPRGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTS
DGIKHAFQTDNSKVCQYLLQLCSSQHKFQLQMRARQSNQDAQDLERASFRSLNLQAESVR
GFNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSAKEKSDKASW
EEKPRGMSKSYHDLSQASLFPHRKNVLVNMESLPQTVVELVGKPFHQTARSDTESLAGFT
KLNNSKSVASLNRSPERRKQESDSSSFEDPGQACVIGMTLHSSGNSSSQVPLKENDVLHK
RWSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGVFISSITPGGPADLDGCLK
PGDRLISVNSVSLEGVSHHSAIEILQNAPEDVTLVISQPKEKISKVPSTPVHVANGMKNY
MKKPSYLQDIALDSSSEDHCWPHGTPRHISENSFGLSGGLREGSLSSQDSRTESASLSQS
QVNGFFASHVGDRTWQESQHGSPSPSVISKATEKKRTSTDSNRSKAKKPGISDATDYSDR
GDSDVDEATYSSSQDHQTPKKESSSSMNTSNKMNFKSFPSSPPKPGDIFEVELAKNDNSL
GISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETL
RNTGQVVHLLLEKGQSPSSKEHVPVAPQCAFLDPDAQGQAPEKMKKMAHVKDYSFVTEEN
TFEVKLFKNSSGLGFSFSREDNLIPEQMNTSIVRVKKLFPGQPAAESGKIDVGDVILKVN
GASLKGLSQQEVISALRGTSPEVSLLLCRPPPGVLPEIDPALLTPLHSPAQVLPNSSKDS
SQPVVVEQVTSSDENEMSDKSKKQRTSPSRRDSYSDSSESGEDDLEKAPAKIPNMSWSSA
LHQTLNNMVSQARSPHEALRSQENTICTMFYYPQKIPNKPELEDSNPPSPLPLDVTPGQS
CQPQSESASTNSMDKYHIYHISEPTRQESLTSLKNDLENHLEDFELEVELLITLIKSEKG
SLGFTVTKGSQSIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAA
PKTVRLVLGRVLELPRMPVLPHLLPDITLTCNKEELGFSLSGGHDSLHQVVYISDINPTS
GAAIEGNLQLLDIIHYVNGVSTQGMTLEEAKRALDMSLPSVVLKATRDGHPVFPSSRRSA
VSTPKSTQANGHHTVEPCGKTALTPNNSFSKVNGEEIIEVLCAEVKSSTYQMKGSANLSL
SKESDIQEDDICDDPQEAEVIQSLLDVVDEEAQNLLNQNSGAGDACAPGALKANEKLSEE
RTEDTDCDGSPLPQDFMESTKMNGCEGCCEEKVKSESLIPKSQERKTDDEITWGSDELPT
EATNHEDSEKDPPFLSSEELAVLPVVRVLPSGRYTGSKLKAVLRMLRGLLDQGIPSKELE
NLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFI
YIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNVVGKTTMVNDRLR
LALVRMQQLKGFVVRAMALEDIQVRELRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHI
HRSGPIVTHCSAGIGRSGTLICIDVVLGLISQDLEFDISDLVRCMRLQRHGMVQTEDQYI
FCYQVILYVLTRLQAEEEQREQPQPLK
Download sequence
Identical sequences F6V0G4
ENSECAP00000013781 9796.ENSECAP00000013781 ENSECAP00000013781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]