SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013850 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013850
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000197
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013850   Gene: ENSECAG00000016309   Transcript: ENSECAT00000017092
Sequence length 205
Comment pep:known chromosome:EquCab2:24:45182465:45188057:1 gene:ENSECAG00000016309 transcript:ENSECAT00000017092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRCMQCDTKFDFLTRKHHCRRCGRCFCDKCCSQKVPLRRMCFVDPVRQCAECALVSHKE
AEFYDKQLKVLLSGATFLVTFGNSEKSETMVCRLSNNQRYLLLDGDSHYEIEIAHISTVQ
VLTEGFPPGGNHGVPFTTLLPCFPPPGGNARATGMSLQYTTPGADGVTQLKLTAGEDANA
SRRQSTAWLAAMHKAVKLLYESRDQ
Download sequence
Identical sequences F6TPK6
ENSECAP00000013850 9796.ENSECAP00000013850 ENSECAP00000013850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]