SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013880 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000013880
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013880   Gene: ENSECAG00000016338   Transcript: ENSECAT00000017125
Sequence length 196
Comment pep:known chromosome:EquCab2:6:40229322:40311418:1 gene:ENSECAG00000016338 transcript:ENSECAT00000017125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSLLPEG
ERLEPFSMKPDREPQL
Download sequence
Identical sequences F6TND5
ENSECAP00000013880 XP_001501395.1.31192 XP_008511745.1.77740 XP_014689688.1.49734 XP_014689689.1.49734 9796.ENSECAP00000013880 ENSECAP00000013880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]