SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013988 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013988
Domain Number 1 Region: 615-798
Classification Level Classification E-value
Superfamily vWA-like 3.2e-52
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 426-613
Classification Level Classification E-value
Superfamily vWA-like 5.63e-50
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 3 Region: 795-989
Classification Level Classification E-value
Superfamily vWA-like 1.81e-49
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 4 Region: 990-1178
Classification Level Classification E-value
Superfamily vWA-like 1.81e-48
Family Integrin A (or I) domain 0.00054
Further Details:      
 
Domain Number 5 Region: 217-410
Classification Level Classification E-value
Superfamily vWA-like 4.87e-45
Family Integrin A (or I) domain 0.003
Further Details:      
 
Domain Number 6 Region: 20-206
Classification Level Classification E-value
Superfamily vWA-like 8.6e-40
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1752-1946
Classification Level Classification E-value
Superfamily vWA-like 1.75e-26
Family Integrin A (or I) domain 0.0046
Further Details:      
 
Domain Number 8 Region: 1963-2104
Classification Level Classification E-value
Superfamily vWA-like 9.05e-22
Family Integrin A (or I) domain 0.0057
Further Details:      
 
Domain Number 9 Region: 1185-1370
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000119
Family Integrin A (or I) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013988   Gene: ENSECAG00000016169   Transcript: ENSECAT00000017239
Sequence length 2110
Comment pep:known chromosome:EquCab2:16:66614250:66706204:1 gene:ENSECAG00000016169 transcript:ENSECAT00000017239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLLSLLLMIICSHVSVNQDSGPEYADLVFLVDSSDHLGTKSFPLVKIFITKLISSLPI
EANKYRVALAQYSDKFHSEFQLGTFKSRNPMLNHLRKNVSFTGGSLRIGNALQEAHRTYF
SGHANSRDKKQFPPILVVLASAESEDDVEEASKALRRDGVRIISVGVQKASEENLKAMAT
AQFHFNLRTVRDLSTFSQNMTQIIKDAAQYKDGAVNDILVEVCQGPSVADVVFLLDVSLN
GSQENFDYLKEFLEESVSALDIKENCMRVGLVAFSNETKVINSLSRGINKSEVLQYIQNL
SPQAGNAYTGAAIRKIRKEVFGAQNGSRKNQGVPQIAVLVTHRPSEDNVTKAAVNLRRQG
VTIFTMGIEGASDTQLEKIASHPAEQYVSKLKSFSDLAAHNQTFLKKLRNQITHTLSVFS
ERTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSELVGMFNIAPQKVRFGAVQ
YADSWDLEFEINKYSNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKAKKERGNKVPC
HLVVLTNGVSKDSIVEPANRLREELIHVYAIGVREANQTQLREIAGEEKRMYYVHDFDAL
KDIRNQVVQEICAQEACKEMKADIMFLVDSSGSIGPENFSKMKIFMKNLVSKSQIGADRV
QIGVVQFSHVNKEEFQLNRYMSQSEISDAIDRMAHIGETTLTGHALTFVSQYFSPAKGAR
PNVRKFLILITDGEAQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVE
NFDILQHIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMTDLVKKA
DVGKNQVRFGALKYADDPEVLFYLDTLGTKWEVISVLQNDQPMGGNTYTAEALAFSDHMF
TEARGSRLQRGVPQVLIVITDGESHDADKLNATAKALRDKGILILAVGIAGANPVELLAM
AGSSDKYFFVETFGGLKGIFSDVSASVCNSSKVDCEIGQIDLVFLMDGSNSIHPDDFKKM
KAFLASVVQDFDVTVNRVRIGAAQFSHNYQPEFPLGTFTGEEEISLQIEKIQQIFGYTHI
GAALRRVGRYFRPDMGSRINAGTPQVLLVLTDGQSQDEVAQAAEDLRRKGINIYSVGIGD
VDDQQLVQITGTADKKLTVHDFDELRKVKKRIVRHICTTGGESNCFVDVVVGFDIATQKS
GQTFLEGQSWMETYLQHILRAISSLNGVSCEVGTETQVSVAFQVTNAMEKYSPKFEIYSE
NILNSLKDITVKGPSLLNANLLSSLWDAFQNKSAARGKVVLLFSDGLDDDIEKLEQKSDE
LRKEGLNALVTVALDGAPDSGDLADLLYIEFGKGFEYRTQLSIGMRDLGSRLSKHLVNVA
ERTCCCLFCKCIGGDGAMGDPGPPGKKGSLGLKGSEGYLGEEGIAGERGATGPVGEQGTK
GCYGAKGPKGNRGLNGQEGDIGESGIDGLNGEQGDNGLAGGKGEKGDEGSQGSPGRRGIS
GDRGAKGWRGDPGFPGVDNSVEGPKGLKGERGRQGRRGSPGPPGTPGSRRKTAAHGRRGH
TGPQGTTGIPGPDGLEGSLGLKGPQGPRGEAGVKGDKGSLGGKGPQGPPGPGGEAGSQGH
LGSQGNKGEPGDLGEKGAAGLPGPRGLPGDDGAPGYGSFGSKGAKGQEGFPGESGPKGEI
GDPGGPGETGPKGVRGKTISTGLPGEPGSPGELGPPGRKGVKGAKGLALFSTCDLIQYVR
DHGQGHNGKPECPVHPTELVFALDQSRDVTEQEFERMKEIVSAFVRGIRVRENSCPVGAR
VAILSYNSHTRHLIRFSDTYKKNQLLREIEAIPYERSSAGREIGKTMRFISRNVFKRTLS
GPHTRRIAAFFSSGQSADAQSIATATMEFSALDIIPVVIAFSNVPSIKRAFMIDDTGTFQ
VVMIPPGADSAQALERLQRCTFCYDVCKLDASCDQAGPPPVQSYVDAAFLLDGSRHVGSA
EFEDIRDFLGALLDHFEITPEPKTSVTGDRVALLSHAPPNFLPNTQRSPVRTEFNLTTYN
SKRLMKRHMEESVRQLNGDTFIGHALQWTLDNIFLNTPNLRRNKVIFVISTGETSHLDRE
TLKKESLRAK
Download sequence
Identical sequences F6QHY2
ENSECAP00000013988 9796.ENSECAP00000013988 ENSECAP00000013988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]