SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014081 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014081
Domain Number 1 Region: 40-489
Classification Level Classification E-value
Superfamily Sema domain 6.93e-138
Family Sema domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 836-894
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 782-833
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000235
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 4 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 485-537
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000497
Family Plexin repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 649-700
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 7 Region: 895-940
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 8 Region: 538-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014081   Gene: ENSECAG00000016241   Transcript: ENSECAT00000017338
Sequence length 1073
Comment pep:known chromosome:EquCab2:21:50116741:50405795:1 gene:ENSECAG00000016241 transcript:ENSECAT00000017338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGPCVIAWLFSSLGWWRLAQPETDASQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQL
TFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSQEECQNYIRVL
LVGGDRLFTCGTNAFTPVCTNRTLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYA
ATAMDFPGRDPAIYRSLGVLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEHD
CGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPELD
LIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTVD
QGLYVNLTERNLQDAQKFILMHEVVQPVTAVPSFMEDNSRFSHLAVDVVQGRDVLVHIIY
LATDYGTIKKVRAPLTQTSSSCLLEEIELFPERRREPIRSLQIVHSQSVLFVGLREHVAK
VPLKRCQFHRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSVSACPTRNLTVDG
HFGAWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPRMEIANCSRNGGWTPW
TSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWGP
WERCTTQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNPCPELKKTTPWTPWTPVNISDN
GGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAH
TVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVD
GMWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCSTQPCPESWSE
WSDWSECDASGVQVRARQCILLFPVGGQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEK
RCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVAPAPLNTSITNH
INKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences F6XCK0
XP_001917420.1.31192 ENSECAP00000014081 ENSECAP00000014081 9796.ENSECAP00000014081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]