SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014177 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014177
Domain Number 1 Region: 259-411
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 149-257
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-23
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 63-149
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-20
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014177   Gene: ENSECAG00000016131   Transcript: ENSECAT00000017447
Sequence length 1040
Comment pep:known chromosome:EquCab2:16:20621610:20787495:1 gene:ENSECAG00000016131 transcript:ENSECAT00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREGGGMASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLRDVYQ
MTEGRHCQVHLLDDRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFTDDTGHQNWL
QLDHRVLDHDLPKKQGPTILHFAVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIEVDS
ETTFKLAALVLQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKVK
GLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDLQDKVKPRKLF
QWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQH
QFYLDRKQSKAKIPSARSLDDIAMDLTETGTPRVSKLVTLEAKSQFIMASNGSLISSGSQ
DSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKIPKEYPLNIGEKP
PQVRRRVGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKR
KQDYADAVKKLQEIENAINEYRIRCGKKPSQKATVILPEDIIPSESSSLSDTATYDDPND
TFAVAGQRSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTL
ERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMENDKPFFS
LSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVAGPYYTTQTLDTRARGRRRSKKQNVST
SNSGSMPNLAQKDSLRNGVYSKSQEQPSSSYYIAGYTPYTECDLYYSGGYVYENDTEGQY
SVNPSYRSSAHYGYDRQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKA
LVAEHLRGWYQRASGQKEQGHSPQTSFDSDRGSQRCLGFAGLQIPCSPSSRASSYSSVSS
TNASGNWRTQITVGLSEYETPAHSYTSCYGNIYNPLPSPGRQYTETSQLDGTDGNRLEDS
LDSSEQRLFWHEDSKPGTLV
Download sequence
Identical sequences F6YIG9
9796.ENSECAP00000014177 ENSECAP00000014177 ENSECAP00000014177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]