SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014182 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014182
Domain Number 1 Region: 75-248
Classification Level Classification E-value
Superfamily E set domains 1.05e-32
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000119
Family Arrestin/Vps26-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014182   Gene: ENSECAG00000016486   Transcript: ENSECAT00000017452
Sequence length 316
Comment pep:known chromosome:EquCab2:21:2775915:2778122:1 gene:ENSECAG00000016486 transcript:ENSECAT00000017452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSGETTTLPPGRHEFPFSFQLPPTLVTSFEGKHGSVRYCIKATLHRPWVPARRARKVFT
VIEPVDINTPALLAPQAGAREKVARSWYSNRGLVSLSAKIDRKGYTPGEVIPVFAEIDNG
STRAVLPRAAVVQTQTFMARGARKQKRAVVASFSGEPVGPGRRALWQGRALRIPPVGPSI
LHCRVLHVDYSLKVCVDIPGTSKLLLELPLVIGTIPLHPFGSRSSSVGSHASFLLDWGLG
ALPEQPEAPPEYSEVVADEVAAGGRSPLPLPQAPDVSLEGPFLAYVREFRYRPPPLYSEE
DPNPPPRARGPRCMTL
Download sequence
Identical sequences F6YID5
ENSECAP00000014182 9796.ENSECAP00000014182 ENSECAP00000014182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]