SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014374 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014374
Domain Number 1 Region: 583-825
Classification Level Classification E-value
Superfamily vWA-like 1.85e-75
Family Trunk domain of Sec23/24 0.00000561
Further Details:      
 
Domain Number 2 Region: 353-501,826-920
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 8.5e-74
Family beta-sandwich domain of Sec23/24 0.00048
Further Details:      
 
Domain Number 3 Region: 1027-1175
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.54e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 4 Region: 922-1026
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.92e-29
Family Helical domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 5 Region: 500-582
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.7e-23
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014374   Gene: ENSECAG00000016518   Transcript: ENSECAT00000017682
Sequence length 1176
Comment pep:known chromosome:EquCab2:2:116150205:116216347:-1 gene:ENSECAG00000016518 transcript:ENSECAT00000017682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAQNQMQFPSGYGLHPQNYIAPSGHYAQGPGKMTSLPLDSQHGDYYSGLYTVPTQNVVT
PNTAGQQPGAQQMYGRVLPAPHMAGSALGSFPGATSSASHVHTSASVNHHNSPAVGAANS
SVASQGFPSTCGHYAMSTVSNAAYPRVSYSSPPAGDPYGQQMFTSQNAPPVRPIRDNSFS
GQNTAISHPSPLPPPPPQQYHQEQSLSGYSTLSWSASGLPSTQDNLLRNHTGSLATANNN
PTSPVADSLSSSVMQNVQPPVSSPVVSTVLSGASSARTPAAACHPAEPAASVTQPSELFQ
QKGVDSSSTTSSASPGPNSYDALEGGSYPDMLSSSASSPAPDPAPESDPTSAPAPAAAQP
SKVAKPFGYGYPALQPGYQNAAAPPGAGPPSASPVYSGFQQYAQQYPGLNQLSSGLGGLS
LQSAPQPESLRPVNLTQDRNVLPVTPVWAPVPNLNLDLRKLNCSPDSFRCTLTSIPQTQA
LLNKAKLPLGLLLHPFRDLTQLPVITSNTIVRCRSCRTYINPFVSFIDQRRWKCNLCYRV
NDVPEEFMYNPLTRSYGEPHKRPEVQNSTVEFIASSDYMLRPPQPAVYLFVLDVSHNAVE
AGYLTILCQSLLENLDKLPGDSRTRIGFLTFDSTIHFYDLQEGLSQPQMLIVSEIDDVFL
PTPDSLLVNLHESKELIKDLLNALPTMFTNTRETHSALGPALQAAFKLMSPTGGRVSVFQ
TQLPSLGAGLLQSREDPNQRSSTKVVQHLGPATDFYKKLALDCSGQQTAVDLFLLSSQYS
DLASLACMSKYSAGCIYYYPSFHCTHNPSQAEKLQKDLRRYLTRKIGFEAVMRIRCTKGL
SMHTFHGNFFVRSTDLLSLANINPDAGFAVQLSIEESLTDTSLVCFQTALLYTSSKGERR
IRVHTLCLPVVSSLADVYAGVDVQAAICLLANMAVDRSVSSSLSDARDALVNAVVDSLSA
YGSTISNLQHSALIAPSSLKLFPLYVLALLKQKAFRTGTSTRLDDRVYAMCQIKCQPLVH
LMKMIHPNLYRIDRLTDEGAIHVNDRVVPQPPLQKLSAEKLTREGAFLMDCGSVFYIWIG
KSCDNNFIEDVLGCPNFASIPQKMTHLPELDTLSSERARSFITWLRDNRPLSPVLHVVKD
ESPAKTEFFQHLIEDRTEAAFSYYEFLLHIQQHICK
Download sequence
Identical sequences F6YGU5
ENSECAP00000014374 ENSECAP00000014374 9796.ENSECAP00000014374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]