SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014376 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014376
Domain Number 1 Region: 158-267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.29e-20
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Domain Number 2 Region: 302-505
Classification Level Classification E-value
Superfamily vWA-like 3.95e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9e-17
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014376   Gene: ENSECAG00000016307   Transcript: ENSECAT00000017686
Sequence length 557
Comment pep:known chromosome:EquCab2:1:161995025:162001306:1 gene:ENSECAG00000016307 transcript:ENSECAT00000017686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEMGWVPEPPAMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVEHT
EVLRSCSSPVFSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQ
TKVTKPLLLKNGKTAGKSTITIVAEEVSGTNDYVQLTFRAHKLDNKDLFSKSDPFMEIYK
TNGEQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTADPGQEMQWDCINPKYRDKKKNYKSSGTVVLARCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA
GPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGTLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTPATTPSPSP
Download sequence
Identical sequences F6YGS8
ENSECAP00000014376 9796.ENSECAP00000014376 ENSECAP00000014376 XP_014589594.1.31192 XP_014589595.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]