SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014410 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014410
Domain Number 1 Region: 39-157
Classification Level Classification E-value
Superfamily E set domains 0.0000000126
Family ML domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014410   Gene: ENSECAG00000016805   Transcript: ENSECAT00000017723
Sequence length 159
Comment pep:known chromosome:EquCab2:20:6808035:6872306:1 gene:ENSECAG00000016805 transcript:ENSECAT00000017723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFMAAFLVWTLISANGGGGEAWPTHTACRDGSLEVLYQSCDPLQDFGFSVDQCSKQLK
SNLNVRFGIILREDIKQLFLDVALFTKGSSILNYSYPVCEEGLPKFTFCGRRKGEQIYYA
GPVNNPGFEIPPGEYQVLLELYNEKHSTVACANATVICS
Download sequence
Identical sequences F6XNB5
ENSECAP00000014410 9796.ENSECAP00000014410 XP_003363846.1.31192 ENSECAP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]