SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014668 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014668
Domain Number 1 Region: 181-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 301-384
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 98-176
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 395-470
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 5 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000892
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014668   Gene: ENSECAG00000016797   Transcript: ENSECAT00000018011
Sequence length 488
Comment pep:known chromosome:EquCab2:4:54887647:55022415:-1 gene:ENSECAG00000016797 transcript:ENSECAT00000018011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFVLKVAYIP
DEMAAQQNPLQQPRGRRGFGHRGSSRQGSPGSASKQKPCDLPLRLLVPTQFVGAIIGKEG
ATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTE
EIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITIKGNVET
CAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTP
PYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVI
ITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTAIVNEL
QNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQAIVAQRKIQEILTQVKQHQQQKALQS
GPPQSRRK
Download sequence
Identical sequences F6XXS9
ENSECAP00000014668 9796.ENSECAP00000014668 ENSECAP00000014668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]