SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014676 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014676
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.42e-43
Family Calponin-homology domain, CH-domain 0.00077
Further Details:      
 
Domain Number 2 Region: 1304-1422
Classification Level Classification E-value
Superfamily E set domains 1.4e-35
Family Filamin repeat (rod domain) 0.00000412
Further Details:      
 
Domain Number 3 Region: 1211-1323
Classification Level Classification E-value
Superfamily E set domains 4.87e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 4 Region: 1122-1232
Classification Level Classification E-value
Superfamily E set domains 6.01e-31
Family Filamin repeat (rod domain) 0.00000126
Further Details:      
 
Domain Number 5 Region: 1498-1613
Classification Level Classification E-value
Superfamily E set domains 6.61e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 6 Region: 944-1032
Classification Level Classification E-value
Superfamily E set domains 1.53e-30
Family Filamin repeat (rod domain) 0.00000353
Further Details:      
 
Domain Number 7 Region: 1411-1516
Classification Level Classification E-value
Superfamily E set domains 2.07e-29
Family Filamin repeat (rod domain) 0.0000223
Further Details:      
 
Domain Number 8 Region: 1723-1818
Classification Level Classification E-value
Superfamily E set domains 1.93e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 9 Region: 345-453
Classification Level Classification E-value
Superfamily E set domains 3.07e-28
Family Filamin repeat (rod domain) 0.0009
Further Details:      
 
Domain Number 10 Region: 158-271
Classification Level Classification E-value
Superfamily E set domains 5.27e-28
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 11 Region: 549-659
Classification Level Classification E-value
Superfamily E set domains 1.6e-27
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 12 Region: 2094-2190
Classification Level Classification E-value
Superfamily E set domains 5.07e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 13 Region: 1036-1145
Classification Level Classification E-value
Superfamily E set domains 9.34e-27
Family Filamin repeat (rod domain) 0.00000421
Further Details:      
 
Domain Number 14 Region: 647-761
Classification Level Classification E-value
Superfamily E set domains 2.6e-26
Family Filamin repeat (rod domain) 0.00068
Further Details:      
 
Domain Number 15 Region: 739-849
Classification Level Classification E-value
Superfamily E set domains 6.61e-26
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 16 Region: 259-357
Classification Level Classification E-value
Superfamily E set domains 2.17e-25
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 17 Region: 1904-1999
Classification Level Classification E-value
Superfamily E set domains 4.4e-25
Family Filamin repeat (rod domain) 0.00000352
Further Details:      
 
Domain Number 18 Region: 2417-2507
Classification Level Classification E-value
Superfamily E set domains 6.61e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 19 Region: 2288-2379
Classification Level Classification E-value
Superfamily E set domains 6.67e-24
Family Filamin repeat (rod domain) 0.0000146
Further Details:      
 
Domain Number 20 Region: 2195-2286
Classification Level Classification E-value
Superfamily E set domains 1.13e-23
Family Filamin repeat (rod domain) 0.0000156
Further Details:      
 
Domain Number 21 Region: 449-545
Classification Level Classification E-value
Superfamily E set domains 2.34e-23
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 22 Region: 2016-2111
Classification Level Classification E-value
Superfamily E set domains 7.34e-21
Family Filamin repeat (rod domain) 0.0000114
Further Details:      
 
Domain Number 23 Region: 857-958
Classification Level Classification E-value
Superfamily E set domains 3.18e-20
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 24 Region: 1814-1902
Classification Level Classification E-value
Superfamily E set domains 3.87e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1661-1737
Classification Level Classification E-value
Superfamily E set domains 2.87e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014676   Gene: ENSECAG00000015849   Transcript: ENSECAT00000018019
Sequence length 2508
Comment pep:known chromosome:EquCab2:16:30290332:30371569:-1 gene:ENSECAG00000015849 transcript:ENSECAT00000018019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIP
YLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQV
ITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQP
AKFTVDTISAGQGDLMVFVEDPEGNKEEAQVTPANDKNKTYSVEYLPKVTGLHKVTVLFA
GQHISKSPFEVNVDKAHGDASKVTAKGPGLEATGNIANKPTYFDIYTAGAGVGDIGVEVE
DPQGKNTVELLVEDKGNQVYRCVYKPVQPGPHVIKVSFAGDTIPKSPFVVQVGEACSPNA
CRASGRGLQPKGIRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFE
YYPSTPGKYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVES
VGSEVGSLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMA
FIHPATGDYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDI
QMKSRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVER
SGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPP
AAGRYTIKVLFASEEIPASPFRVKVDPSHDASKVKAEGPGLTKSGVENGKPTHFTVYTKG
AGKAPLNVQFSGPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGSMQVLVTYGGDPIPKSPF
TVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTKGAGGQGKLDVTILSPSRKVMPCLVA
PVAGRESSTAKFVPREEGLYAIDVTYDGHPVPGSPYAVEASLPPDPSKVKAHGPGLEGGL
VGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE
EVHIPGSPFKADIEMPFDPSKVVASGPGLQHGKVGEAGLLSVDCSEAGPGALDLEAVSDS
GAKAEVCIENNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVF
GPGIEGKDVFREATTDFMIDSRPLTQVGGDHIKAHIANPSGASTPCFITDNADGTYQVEY
TPFEKGLHVVEVAYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTR
GAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVP
VKDVVDPSKVKIAGPGLGSGVRARILQSFTVDSSKAGLAPLEVRVMGPRGLVEPVNIVDN
GDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPA
SLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTY
GGDEIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLT
PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEE
APVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATP
EIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYG
VANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKY
NDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLL
KRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSE
GRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTK
FADEHVPGIPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDMSAHVT
SPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAH
KVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIA
QEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNG
AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHMIDVKFNGSHVVGSPFKVR
VGEPGQAGNPALVSAYGAGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET
PEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVT
RSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTT
PCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences F6XT77
ENSECAP00000014676 ENSECAP00000014676 9796.ENSECAP00000014676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]