SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014728 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014728
Domain Number 1 Region: 1206-1310,1369-1505
Classification Level Classification E-value
Superfamily Cullin homology domain 9.68e-40
Family Cullin homology domain 0.0011
Further Details:      
 
Domain Number 2 Region: 805-961
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.93e-36
Family APC10-like 0.006
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-32
Family CPH domain 0.00000674
Further Details:      
 
Domain Number 4 Region: 118-195,473-562,672-756
Classification Level Classification E-value
Superfamily ARM repeat 0.000000144
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000014728
Domain Number - Region: 1543-1642
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00635
Family Penicillinase repressor 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014728   Gene: ENSECAG00000017053   Transcript: ENSECAT00000018078
Sequence length 1694
Comment pep:known chromosome:EquCab2:20:42089837:42102846:-1 gene:ENSECAG00000017053 transcript:ENSECAT00000018078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDDGEGGSGQVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQETGGEAGALDKSVLGEMETDVKSLIQR
ALRQLEECVGSIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRLLFSLVKHYLHVTFLLDKLNDSAAEPGMQNNSAPEELSGERGRLELEFSMAM
GTLISELVQAMRWDWASSRQGPLARSSCSIFQPQLTDAGPGLPPAQAQPSLRRSRRFRPR
SEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNSGVPPVQVLWESTGRT
YWVHWHMLEILGFEEDIENVVKADEYKGAVVTGALGAALPSWRWKPMTELYAVPCVLPED
EDTEESEHLTQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEVLAELAVPMELA
QDLLLALPQRLDDSALRDLFNCRVYRKYGPEALAGQPAYASLLEAQAQPQESADAARVEA
KEPPTQCPNTPLRRLAEGYGQPGKIFLDLEQALSSEGARDSEVKPLLLQLQRQPQPFLVL
MRSLDTPAANKSLHLTVLRILTQLVDFPEALLLPWHEAMDACMACLRSPDTDREVLQELI
FFLHHLASVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKL
TTNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRHLCQGSSVEVKEEKCWEKVEVSSN
PHRASKLTDRNPKTYWESNGSAGSHYITLHMHQGVLIRQLTLLVAGEDSSYMPARVVVFG
GDSTSSLNTELNSVNVMPSASRLILLENLNRFWPIIQIRIKRCQQGGIDTRIRGLEVLGP
KPTFWPVFQEQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLHGALRHEQNFADGFL
PDNEAAQALGKTCWEALVSPLVQNITSPDEDGVSPLGWLLDQYLECREAAHNPQSRAAAF
SSRVRRLTHLLVHVEPCEVPPLVVATPRPQGRNRSHDWSSLATRGLPSSIMRNLTRCWGA
VVEEQVNNFLTSHWRDDDFVPRYCEHFNNLQKSSSELFGPRAAFLLALQNGCAGALLKLS
FLKAAHVSEQFARHIDQRIQGSRIGGARGMEMLAQLQRCLETVLVFSGLEIATTFEYYYQ
HYMADRLLGVGSSWLEGAVLEQIGLCFPNRLPQQMLRSLSTSEELQRQFHVYQLQRLDQE
LLKLEDTEKKMQVGGGHGASGKEYERENEEEAEEAGAAAAAADKAEVEEEEENEDLYYEG
AMPEVSVLVLSPRCWPIASICHTLNPKICLPSYLRGTLNRYSNFYNKSQSYPVVERGPQR
RLQWTWLGRAELQFGDQTLHVSTVQMWLLLYLNDLKEVSVESLLALSGLSQDMLNQAIGP
LTSLRGPLDLHEQKDVPGGVLKIRDASEEPRPRRGNVWLIPPQTYLKAEDEEGRNLEKRR
NLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGRGSACSSTDVLSC
ILHLLGKGTVRRHDDRPQTLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVP
YASCTGTQSFSTFR
Download sequence
Identical sequences F6WY43
ENSECAP00000014728 ENSECAP00000014728 9796.ENSECAP00000014728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]