SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014740 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014740
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily vWA-like 0.0000572
Family Ku80 subunit N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014740   Gene: ENSECAG00000017099   Transcript: ENSECAT00000018090
Sequence length 313
Comment pep:known chromosome:EquCab2:21:2277487:2283164:1 gene:ENSECAG00000017099 transcript:ENSECAT00000018090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEEEEEEGEQSSQPRPRTRSNPEGAEDRALGAQASVGSRSEGEGEAASADDGTPNPPGA
GPKPWQVPPPAPEIQVRTPRVNCPEKVILCLDLSEEMALPKLESFNGSKTNALNVSQKMI
EMFVRTKHKIDKSHEFALVVVNDDIAWLSGLTSDPRELCSCLYDLETASCSAFNLEGLVS
LIQQKTELPVTENVQTIPPPYVIRTILVYSRPPCQPQHGVTRVPNAGKMFQCPYFFFDIV
YIHNGSDEKEEEMSWKDMFTFMGSLDTKGTSYKYEVALAGAGPGAAQLHGQAAGSPTTAA
LPEPRLLQPSGGG
Download sequence
Identical sequences F6WXE0
ENSECAP00000014740 ENSECAP00000014740 9796.ENSECAP00000014740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]