SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014934 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014934
Domain Number 1 Region: 509-657
Classification Level Classification E-value
Superfamily vWA-like 3.02e-19
Family Integrin A (or I) domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000014934
Domain Number - Region: 1032-1082
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0201
Family Tudor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014934   Gene: ENSECAG00000016966   Transcript: ENSECAT00000018315
Sequence length 1245
Comment pep:known chromosome:EquCab2:15:11004018:11180724:-1 gene:ENSECAG00000016966 transcript:ENSECAT00000018315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSGSSSTISEQQLWSQEGLSNATTDLAEQSLISSEEWLQLHGLKSNKLTLKQILSQIG
FPHCEDYVTSLGRPVASRYADGLFPQFYRAEDGRVYNLTAKSELICQFVEDLAEAVETYK
LRMDWLTSKSRQIFGVILEQCITIVLDFGGMLEEELNLCQDALIMVLQEQVAHIAKFNII
WVSQEPVKWQENATPVTEQSIAAAISWVEKLTFELAVSQSSRLDALLEAGKDTTIESIYY
FVVGDVPEECKELLLESALESPYPVCTVSFNARGEGTVAFLKDLSAKTCSRFHAFAERTG
CVEFPAFPIKDGGSVSTWNSRKLKGQLPPGAGVREDVFLIWKEMEEACSTLAQIQRLVAE
LPKSAVATTDCESGATSVENESNPEVTWDSKKWLQKHGLKAQRLSFYDVLADCAFRHADG
VVDIKAKPENESVQTSAETNKKTIHAKYCSRFVHAPWKDGSLVHVCITKEKCTWYSERVH
AVLACIQRRIKWLQERSQMLFGKLRNDCVYILIDTSHSMKGKLDLVKDKIIQFIQEQLKY
KRKFNFVQFDAQAIAWREKLVEIDEDNLKRAQSWVRDIKIGSSTNTLNALQIAFADKETQ
AIYLLTDGRPDQPLEMVIDQVKVFQKIPIYAISFNYNDEIANGFLKELAALTGGQFHSYD
FGCKDPCPSEAVQNEDLTLLIKEMEQGRSDLEKVQNLYSESLIMDWWYNGEKEGDNKHQK
EICSMVSTPEKCGKPYSDVESARTSSLNMLKVPGDLSNQKTQKKKVLHAESTKTSLLRSQ
MSTLKSSACSERKDGLSHSSSWNTPRDREMSILLANGYPDDKALERLTLEGSQVYDQDSL
AVSSATWLKTHGLVAKKLTIMDALSVTAVPHSPTYVPILDKHVVSKVFDEVFPLAHVCHD
TNKMTLINPQGVNLNIYKQKVEQAIKSYERHLNKIVWRALSQEEKEKLDANKPIQYLENK
AALNEALERLNWPISLKELSMLENEILAGKIYVQQAMELQEAAKKNYVSKALGEQEKFQE
NPTKKIKSKKLDPLKGQKVIARCDENGFYFPGVVKKCVSPTHALVGFTYGDTKIVPTSFI
TPVGGAMPCPLLQVGDYVFAKIVVPNGFDFYVPAIVIALPNQNVAEDKFYTVLKCNNRRE
FCLRSALIKISQNKYVLSCSHIKSLPMQDSKMEDVDTRNSTFLVRALREVDTRDLRELRQ
ENPRRKKKKPAKRLPLQEMVSLDSDDSSRGIRSQESYHKKHPKPK
Download sequence
Identical sequences F7AYD8
9796.ENSECAP00000014934 ENSECAP00000014934 ENSECAP00000014934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]