SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014994 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014994
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily vWA-like 1.88e-30
Family Integrin A (or I) domain 0.0000173
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000014994
Domain Number - Region: 173-231
Classification Level Classification E-value
Superfamily E set domains 0.0952
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014994   Gene: ENSECAG00000017380   Transcript: ENSECAT00000018380
Sequence length 267
Comment pep:known chromosome:EquCab2:1:83114669:83134764:1 gene:ENSECAG00000017380 transcript:ENSECAT00000018380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGSVDNNWMDIYNFVDRVVKKFENPKLRMSFITYSTRGHTLMNLTSDRNEIHDGLDRLQ
NVVPSGDTNMQEGFKKANEQIQQVYSKDREAASLIIALTDGPLLPSSFNKTKDEAANSQK
MGASIYCVGVSNYKKDQLLEIADRPDHMFGVDRGFKGLRNIVNSLTSKCCMEITAVEPSS
FCTGETYEVKISGKGFNNAKNKDEVICRFKFSNTELFDKKATSVEDTTIICPEVKIEKPG
QEITTEVSLNNAISFINNDVRISSKDC
Download sequence
Identical sequences F6ZWC1
9796.ENSECAP00000014994 ENSECAP00000014994 ENSECAP00000014994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]