SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014998 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014998
Domain Number 1 Region: 2687-2799
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-36
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 930-1040
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-36
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 1389-1505
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-35
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 4 Region: 1051-1157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-35
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 5 Region: 588-700
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 6 Region: 3152-3277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 7 Region: 1624-1732
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 8 Region: 2226-2333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 9 Region: 1737-1847
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 10 Region: 1163-1274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 11 Region: 3392-3504
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 12 Region: 2334-2446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 13 Region: 1508-1616
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-31
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 14 Region: 3034-3146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 15 Region: 2450-2563
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 16 Region: 1281-1386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-28
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 17 Region: 1856-1962
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-27
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 18 Region: 822-926
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-27
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 19 Region: 1989-2088
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 20 Region: 473-584
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2913-3035
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-27
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 22 Region: 2090-2211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 23 Region: 2569-2685
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-26
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 24 Region: 3508-3611
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 25 Region: 706-812
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-21
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 26 Region: 3283-3389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-19
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 27 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.01
Further Details:      
 
Domain Number 28 Region: 431-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 29 Region: 391-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.016
Further Details:      
 
Domain Number 30 Region: 261-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000675
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 31 Region: 169-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000111
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 32 Region: 2818-2915
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000262
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000014998
Domain Number - Region: 213-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0182
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014998   Gene: ENSECAG00000016638   Transcript: ENSECAT00000018387
Sequence length 3621
Comment pep:known chromosome:EquCab2:29:18313131:18568498:1 gene:ENSECAG00000016638 transcript:ENSECAT00000018387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRNMSSPFLWSLILLLTFAELDGEAGGLELQRQKSSDLQQPRMTTERGNLVFLTGSAQNI
EFRSGSLGKIKLNDEDLDECLHQIQKNKDDITDLKRSAIGLPQNISSQIYQLNSKLVDLE
RKLQSLQQTVDRKVCSSNPCQNSGTCLNLHDSFFCICPSQWKGPLCSVDVNECEIYSGTP
LACQNGATCVNTAGSYSCLCSPETYGPQCASKYDDCERGSTVLCVHGICEDLVRVQAGQP
KYSCICDAGWMSPSNSSACTLDRDECSLHPGPCSTLVQCFNTPGSFYCGPCPTGWQGNGY
NCQDINECEINNGGCSVAPPVDCVNTPGSYHCEACPPGYQGNGRVCTLIDICSVDHGGCH
SHATCSSVLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIETVSGYLCKCE
AGWAGVNCTENINECLSNPCLNGGTCVDGINAFSCECTRFWTGFLCQIPQQVCGGSLSGM
NGSFSYRSPDGDYVHDINCFWVIRTEEGKVLRITFTFFQLESVSNCPHEFLQIHDGDSSA
AFQLGRFCGSRPPNELLSSDNALYFHFYSEHLRNERGFTIRWETQQPECGGVLTGTYGSL
TSPGYPGNYPPGRDCVWKVITSPDLLITFTFGTLSLEHHEDCSKDYLEIRDGPLYQDPVL
GKFCTTFSVPPLQTTGPFARVHFHSDNQINDQGFHITYLTSPSDLPCGGNYTDAEGLLSA
DLSGPFTRNRQCVYIIKQPLGEQIQVNFTHVELEGQSGCSQSYIEVREDETLLGKVCGNE
TFSHIKSIASSIWIRLKIDASVVRASFRALYQVACGGELTGEGVIRSPFYPNVYPGEKIC
RWTIHQPQSQVVLLNFTSFEIGSSAHCDTDYIEIGSSSILGSPENKKYCGTDISPFITSV
YNFLYVVFVKSSSTENRGFVAKFSTADLACGAIHTESTGTIQSPGHPNVYPHGVNCTWHI
LVQPGHLIRLTFRTFNLEFHYNCTKDYLEIYDTGSEIFLGRYCGKSIPPVLTSSTNSLML
ILVADSDLAYEGFLINYEAIDASAACLEDYTDESGTFTSPNFPNNYPNNWKCIYRITVET
SQQIALHFTNFSLEDAIGGRCIADFVEIRDGGYETSPSLGQYCGSNLPPRIISHSNKLWL
KFQSDALDSGPGFSAYWDGSLTGCGGNLTTRTGTFTSPNYPMPYYHSSECSWWLKPSHGI
PFELEFEDFHLEYHPNCTLDYLAVYDGPSTSSHLLSQLCGDEKPPPIRSSGDSMTLKLRT
DEGQQGGGFLAKYKQTCTNVVIVNRAYGILESIHYPNPYSDNQRCNWTIQATTGNTLNYT
FLAFELENHANCSTDYLELYDGPQWMGRYCGADIPLPGSTTGSKLQVLFHTDGVGHREKG
FQMQWFIHGCGGEFSGATGSFSSPGYPNTYPPSKECIWYIHAAPGSSIQLTIHDFDVEYH
ANCLFDVLEVYGGPDFHSPRIAQLCAQRSLENPMQISSTGNELAIRFKTDSSVNGRGFNV
SWRAVPGGCGGVFQAPSGEIHSPNYPSPYRSNTECSWVIRVERNHRVLLNFTDLDLEPQD
SCIVVYDDVTHTTTRLASVCGRQQLTNPITSSGNSLFVRFRSGPSRQSKGFRARFRQSKG
CHILTDSFDTISSPLFPAKYPNNQNCSWIIQAQPPFNHITLSFRHFGLESSTPCTKDFLE
ILDGSYDDAPLRGRYCGTSMPHPITSFSNALTLRFISDSRMNFDGFHATYAASSSACGGN
FHMAEGTVNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSPDCSRDFVEIRQG
NATGHLVGRYCGSVLPLNYSSILGHVLWIRFVSDGSGSGTGFQATFTNIFGNDNIVGTHG
KVASPLWPGNYPHNSNYQWIVNVNESQVIHGSILEMDIEAANYCYYDKLRIYDGLGVHSR
LIGTYCGTQTESFSSSRNSLTFQFSSDSSVSGKGFLLEWFAMNVSAGPLPTVATGACGGF
LRTGDAPVFLFSPGWPERYNNRADCMWLIQAPDSTVELNILSMDIEAHRTCNFDKLVIRD
GDDNLAQQLAVLCGREIPGPIRSTGEYMLLRFTSDFSVTGAGFNASFHKSCGGYLHADRG
IITSPKYPETYAPNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLKNGPDI
YSPPLGPRGGNGHFCGSRPSSTLFTSDNQMFVQFVSDNSNGGQGFKIRYEAKSLACGGNI
YIHDADSAGYVTSPNHPDNYPQHADCIWLIAAPPGKLVRLQFEGQFNIEVTPNCTSNYLE
LRDGADSNAPVLSKLCGTSLPRSQLSSGDMMYLRFRSDSSPTHVGFKAKYSIAQCGGTVT
GQSGVVESIGYPTLPYRDNLFCEWHLEGPSGHYLTIHFEDFNLQNSSGCENDFVEIWENH
TSGNLLGRYCGNTIPDSVDTSSNVALVRFVTDGSLTASGFRLRFESSREECGGDLQGPIG
TFTSPNYPNPNEHGRVCEWRITGQEGRQITLTLNNLRLDAHPSCNTERLTVFNGIRSNSP
QLEKMCSSVNVSNEIKSSGNTMKVIYFTDGSRPYGGFSASYTSSEDAVCGGSLANSPEGN
FTSPGYNGVSNYPRNLNCEWTVSNPNQGNSSIYIRFEDFYLESHQDCQFDVLEFRVGNAD
GPLMWRLCGPSSPAMPLVIPYPQVWIHFVTNERVEHVGFHAEYSFTDCGGIQTGESGVIT
SPNYPASYDSLTHCSWLLEAPQGHTITLTFTDFDIEAHSTCAWDSVTVRNGGSPGSPIIG
QYCGSSNPRTIQSGSNQLVVIFNSDHSVQNGGFYAMWSAQTLVCRFPLPSDKANTTNTHW
GDNICKNSLCSYLSLSKKLLYIVSLDIIFLKPSLLGSCQPNQVKVWAGTEEVDKALLATG
CGNVAPGSIITPRNAFTAVFQSQEAPAQGFSASFVSRCGRNFTNPSGYIVSPNYPKQYDN
NMNCTYLIEADPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSLASTPFATVCGDE
SLSPVSISGPMLLNFYSDAHTTDFGFKFSYRIISCGGVFNFSTGTIKSPAYSYSDYPNNM
YCLYSITVRDDRVVQLKFSDFDVVPSTFCSQDYLAIHDGSNISDSLLGKFCGSKLPANVK
SSNNSMLLVFKTDSFQTARGWKVSFQQTLGPRQGCGGYLTGSNYSFASPDSDSNGRYDKS
LNCIWFITAPINKLIKLTFNTFALEAATTLQRCVYDYVKLYDGDSENANLAGTFCGSTVP
APFVSSGNFLTVQFVSDLTLEREGFNATYTIVDMPCGGTYNATWSPQSISSPNSSNPEVP
ISICTWVIEAPPHQQVKITVWALELQSQDCRQNYLEFQDSPESNGNLGIQFCGRNASTAP
TFYSSMTTAIVIFKSEAFSRNSRVGFTYQIAGCNREYNKAFGNLKSPGWPDNYNDNMDCT
VILRAPQNHTISLFFHSFGIEDSSECRHDFLEVRNGSFSSAPLLGTYCGTLLPNPVFSQN
NELYLRFKSDSATSSHGYEIVWTSSPSGCGGTLYGDRGSVTSPGYPGTYPNNTHCEWALI
APAGRPVTVSFPFISIDDPGDCVQNSLLLYDGPDANSPSSGPYCGADSNVAPFVASSNRV
FIKFHAEYAVRPSAIRLIWDS
Download sequence
Identical sequences F6ZW56
ENSECAP00000014998 9796.ENSECAP00000014998 ENSECAP00000014998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]