SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015072 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015072
Domain Number 1 Region: 49-520
Classification Level Classification E-value
Superfamily Sema domain 1.7e-155
Family Sema domain 0.0000000573
Further Details:      
 
Domain Number 2 Region: 516-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000977
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015072   Gene: ENSECAG00000016676   Transcript: ENSECAT00000018472
Sequence length 1075
Comment pep:known chromosome:EquCab2:1:142016554:142068568:-1 gene:ENSECAG00000016676 transcript:ENSECAT00000018472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFLLCAYMLLLMISQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEIPKTEVIPSKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQ
SITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVP
EDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRIR
YRLTAIAVDHSAGPYQNYTVIFVGSEAGVVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCN
AENEEDRKVISLQLDKDHHALYVAFSSCVIRIPLSRCERYGSCKKSCIASRDPYCGWLSQ
GICGRVTPGMLVGGYEQDTEYGYTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVT
TMASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQM
VHMNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLN
GLFDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAALPTPESTP
VLHQKTLQAMKSHSDKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYN
TSFSNSNAHKAEKKLQNIDHSLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMG
DIQMAHQTLMLDPMGPMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSL
ERQRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVS
VHLQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTTSVRPLNKYTY
Download sequence
Identical sequences F6SZV7
9796.ENSECAP00000015072 ENSECAP00000015072 ENSECAP00000015072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]