SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015093 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015093
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015093   Gene: ENSECAG00000017545   Transcript: ENSECAT00000018500
Sequence length 211
Comment pep:known chromosome:EquCab2:2:31187990:31194365:-1 gene:ENSECAG00000017545 transcript:ENSECAT00000018500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCRCAAEQEEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTD
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHRVHQVTPQTHFIS
Download sequence
Identical sequences F6SZD6
9796.ENSECAP00000015093 XP_001504264.1.31192 ENSECAP00000015093 ENSECAP00000015093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]