SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015094 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015094
Domain Number 1 Region: 34-155
Classification Level Classification E-value
Superfamily E set domains 6.53e-16
Family ML domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015094   Gene: ENSECAG00000017538   Transcript: ENSECAT00000018501
Sequence length 160
Comment pep:known chromosome:EquCab2:9:12548130:12574783:-1 gene:ENSECAG00000017538 transcript:ENSECAT00000018501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFMLFFTLFSSIFPEPEELRWICNSSDMSIWYTYCDNMKSPISINLEPCIELKGTRGH
LHMLFVPRRDIKKLYFNLYLTMNSLEFPMRKEVICRGSDDDYSFCRALKGETVNTTVSFS
FRGMRFPKGRYSCIAEAVVGNTEEALFCLNFTLLHQPSFN
Download sequence
Identical sequences Q6TGR2
ENSECAP00000015094 ENSECAP00000015094 NP_001075367.1.31192 9796.ENSECAP00000015094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]